KEGG   Pyrobaculum islandicum: Pisl_0124Help
Entry
Pisl_0124         CDS       T00444                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pis  Pyrobaculum islandicum
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pis01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:pis00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
115878..116627
Genome map
AA seq 249 aa AA seqDB search
MDFLTAVRKTVELRLATEPPPPTRTTPLLDFTKALGDFGIIAEYKRASPRGVVRLDLPPW
AYFAELYSYASAFSVLTEPFWFLGDYRFIPIAKTFKPVLMKDFVIDKRQIEMAYGYGADA
VLIIYRLVDREKAMELAEYAQRLGLTPLVEVDNVQDAKEVATWGGRVVIGINARDLRTLE
TNLIRAFEIAKSLRGDVDYIIESGISKPEEVEKACLLYARGVLIGTALMKNPALAKELKT
VAENCVARR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggattttctcaccgcagttagaaaaactgtcgaactccggctggccacagagccgccg
ccccccacgagaacaactccattgctagactttacaaaagccctcggagacttcggcatt
attgcagagtataaacgtgcgtcgccccgcggcgtagttagactagacctcccgccctgg
gcttacttcgcagagctatacagctacgcctcggccttctccgtcctcacagagcccttt
tggttcctcggagactatcgcttcatacccatagccaaaaccttcaagcccgtcctcatg
aaagactttgtaatagacaagagacagatagagatggcgtatggctatggcgcagatgcc
gtcttaataatataccggcttgtagatagagaaaaggccatggagctcgccgaatacgcc
cagagactgggtctcacccccctggtagaggtggacaacgtacaagacgccaaagaggtc
gccacgtggggcggaagggtggtaatcgggataaacgccagggacctccgcactttagaa
acaaacctcataagggcctttgagatagccaagtcgctaagaggagatgtagattacata
attgagagcggcatttccaagccggaggaagtggagaaggcttgtctcctatacgccagg
ggggtgttaattggcacagctcttatgaaaaaccccgccttggcaaaagagttaaagacg
gtagctgaaaactgtgttgcaagacgctaa

DBGET integrated database retrieval system