KEGG   Pyrobaculum islandicum: Pisl_0124Help
Entry
Pisl_0124         CDS       T00444                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01130  Biosynthesis of antibiotics
pis01230  Biosynthesis of amino acids
Module
pis_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pisl_0124
Enzymes [BR:pis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pisl_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: ABL87307
JGI: Pisl0124
UniProt: A1RQS5
Position
115878..116627
Genome map
AA seq 249 aa AA seqDB search
MDFLTAVRKTVELRLATEPPPPTRTTPLLDFTKALGDFGIIAEYKRASPRGVVRLDLPPW
AYFAELYSYASAFSVLTEPFWFLGDYRFIPIAKTFKPVLMKDFVIDKRQIEMAYGYGADA
VLIIYRLVDREKAMELAEYAQRLGLTPLVEVDNVQDAKEVATWGGRVVIGINARDLRTLE
TNLIRAFEIAKSLRGDVDYIIESGISKPEEVEKACLLYARGVLIGTALMKNPALAKELKT
VAENCVARR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtggattttctcaccgcagttagaaaaactgtcgaactccggctggccacagagccgccg
ccccccacgagaacaactccattgctagactttacaaaagccctcggagacttcggcatt
attgcagagtataaacgtgcgtcgccccgcggcgtagttagactagacctcccgccctgg
gcttacttcgcagagctatacagctacgcctcggccttctccgtcctcacagagcccttt
tggttcctcggagactatcgcttcatacccatagccaaaaccttcaagcccgtcctcatg
aaagactttgtaatagacaagagacagatagagatggcgtatggctatggcgcagatgcc
gtcttaataatataccggcttgtagatagagaaaaggccatggagctcgccgaatacgcc
cagagactgggtctcacccccctggtagaggtggacaacgtacaagacgccaaagaggtc
gccacgtggggcggaagggtggtaatcgggataaacgccagggacctccgcactttagaa
acaaacctcataagggcctttgagatagccaagtcgctaagaggagatgtagattacata
attgagagcggcatttccaagccggaggaagtggagaaggcttgtctcctatacgccagg
ggggtgttaattggcacagctcttatgaaaaaccccgccttggcaaaagagttaaagacg
gtagctgaaaactgtgttgcaagacgctaa

DBGET integrated database retrieval system