KEGG   Pyrobaculum islandicum: Pisl_0229Help
Entry
Pisl_0229         CDS       T00444                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pisl_0229
Enzymes [BR:pis01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Pisl_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(219621..221534)
Genome map
AA seq 637 aa AA seqDB search
MEEARERRVVYPFAAIVGQEKAKLALLAVSVNPAIGGVLLAGDKGTGKSTMVRALADLLP
EIEVVEGCPFGCNPHNPAEMCDECYLKWKRGEIKVAKRKMRVIDLPLSITVDRLVGTLDI
KRALAEGIRALQPGLLAEANRNILYIDEVNLLDDYIIDVLLDAAAMGWNIVEREGISVKH
PARFILIGSMNPEEGELRPQLLDRFGLYVKVEASMNPEERIEIIRRVEEFNRDPTAFYRK
WEPEQNRLREAISRARQIVNDVQIDEDLMKFIVKTITDLKIRSHRAEITVVRTAKAIAAL
DGRLKVNLDDVKKAMELALPHRLKATPFEPPPPPPASPPPSPQQNDGGGDRGPQGGGGGQ
GGGEAGGGRGGGGKQFGEEKPPYEPRETPVRLRGEEEGGGGRRARRAYELKIGGSHGVVT
TYAIPRGEAVDIHITATLTAAALRRLGAGLPLAVDNEDLRINVRRARVPVLRVVLLDSSG
SMAALRRIAVAKGLVRKLAESSYRGREYISLIVFRGGGAQVVVPPVRKYEEILAALSAVP
TGGRTPLPHALETLYRIAKSFRAKYRDAKVVGVLITDGKANVPLYRNVREDLERLSHLLK
KAGVELEIYATRGRGFDPAPTYIDLIASITSAKVVEV
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggcgagggaacgccgggttgtctaccccttcgccgcgattgtaggccaggaa
aaggccaagctggctctattggcggtctcggtaaaccccgccattggcggggttctcctc
gccggagacaaggggacgggcaaatcgactatggtgagggcgctcgccgacctcctccct
gagatagaggtggtagaggggtgccccttcggctgcaacccgcacaacccggcggagatg
tgcgacgagtgttacctgaagtggaaaagaggcgagataaaggtggcgaagaggaagatg
cgcgttatagacctccccctaagcatcacagtggataggttggtggggacgctcgacata
aagagggcgctcgccgaggggataagagcgcttcagccgggcctcctcgccgaggctaac
cgaaacatactgtatatagacgaggtaaacctactagacgactacataatagacgtcttg
ttagacgctgcggcgatgggctggaacatcgtggagagagagggcatatccgtgaaacac
ccagcccgattcatattaatcggtagtatgaacccagaggagggcgagcttaggccccag
ctgttggacagattcggcctatatgtgaaggtggaggcctccatgaacccggaggagagg
atagagataatcaggagggtcgaggagttcaacagagacccaacagccttctacagaaag
tgggagcccgagcagaacaggcttagggaggctatatctagagctagacagatcgtcaac
gacgtccaaatagacgaagacctcatgaagttcatagtcaagactataacagacctaaag
atcagaagccacagggcagagattacggtcgttagaacagccaaggccatagccgccctc
gacggccgcctcaaggtcaacctagacgacgtgaaaaaggccatggagctcgccctaccc
caccgcctcaaggcaacacccttcgagccgcctcccccgcctcccgcaagccctccgcca
tctccccagcagaacgacggcggaggcgacagagggccgcagggaggcggagggggacag
ggagggggagaggcaggcggcgggaggggaggcggggggaagcagttcggcgaggagaag
cccccctacgagccccgggagacgcccgtccgccttaggggggaggaggaggggggcggc
gggaggcgggctaggagagcctacgagcttaaaatcggcgggagccacggcgtagttaca
acctacgcgatcccaaggggggaggcggtggatatacacatcaccgcgacgttgacagcc
gcagcgctcagaaggctaggcgccggcctccccttggccgtagataatgaggatcttagg
ataaacgtaagaagagctagagtgcccgtcctccgcgtcgtcctgcttgactcaagtggg
agcatggccgccttgaggaggatagcggtggcgaaggggctagtgagaaagctagcggag
tcctcctacagggggagggagtacatctcgttgatcgtcttcagaggaggcggagcccag
gtggtggtgccccccgtgaggaaatacgaggagatcctcgccgccttatccgcagtaccc
accggcggcagaacgccgttgccccacgccctggagaccctctataggatagccaaaagc
ttcagggctaaatacagagacgccaaggtggtgggggtcttgataacagacggcaaagcc
aacgtcccactgtatagaaacgtaagagaggatctggagaggctctcccacctgttaaag
aaggcgggtgtggagctggagatatacgccaccagaggcagaggcttcgacccagccccc
acctacatagacctaatagcgagcatcacctcggccaaggtagtagaggtgtga

DBGET integrated database retrieval system