KEGG   Pyrobaculum islandicum: Pisl_0270Help
Entry
Pisl_0270         CDS       T00444                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pisl_0270
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_0270
   00620 Pyruvate metabolism
    Pisl_0270
   00640 Propanoate metabolism
    Pisl_0270
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_0270
   00680 Methane metabolism
    Pisl_0270
Enzymes [BR:pis01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pisl_0270
Lipid biosynthesis proteins [BR:pis01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pisl_0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(270256..272259)
Genome map
AA seq 667 aa AA seqDB search
MHQVLKEELPFNEYVINERWKSRLIDINAYKALHTKSLEQLEEFWASIARELEWFKPWDK
VLDASNPPFYKWFVGGKLNLSYLALDRHVKTWRKNKLAIEWEGEPVDENGNPTEQRKLTY
FDLYREVNRAAYMLKHNFGIRKGDRITLYMPMIPELPIVMLAAWRIGAVTSVVFSGFSAE
ALAERINDSQSRIVVTVDGFWRRGKVIRLKEIVDQALEKVGTVENVIVYRRLGLKDVPMT
EGRDYWWHKVMEGIKANAYVEPEPLESEHPSFILYTSGTTGKPKGIVHDTGGWAVHVYAT
MKWVFDLREEDIYWCTADIGWVTGHSYVVLGPLMIGATQVIYEGAPDYPQPDRWWAIIER
YGVTILYTSPTAIRMFMRYGEEWPRRHDLSTLRIIHSVGEPINPEAWRWAYKVLGNENVA
MASTWWMTETGGIVISHTPGLYLIPMKPGTNGLPLPGFDVDVFDDNGKPAPPGVRGYLVI
KRPWPGMLHGIWGDPDRYIKTYWSKFPGVFYAGDYAIKDQDGYIWVLGRADEVIKVAGHR
LGTYELESALVSHPTVAEAAVVGVPDPIKGEVPIAFVVLKQGVMPSDELRKELRDHVRKT
IGPVAEPAHIFFVTKLPKTRSGKIMRRLLKAVATGAPLGDTTTLEDETSVEEAKKAYEEL
RREIARG
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgcaccaagtgttgaaagaagaattgccattcaacgaatatgtaataaatgagaggtgg
aagagcagattaatagacataaatgcgtataaagctcttcatacaaaatcgcttgaacag
ctagaggaattctgggcatctatagctagagaactggagtggttcaagccctgggacaaa
gtgcttgatgcttcaaacccgccgttttataagtggtttgtaggcgggaaattaaatctc
tcttacttggccttagatagacatgtaaaaacatggcgtaaaaacaagttagctattgaa
tgggagggagagcctgttgacgaaaatgggaaccctacagaacaacgtaaattgacatat
tttgatctctatagagaggtaaatagagcggcttatatgttaaaacacaactttggaatt
agaaagggcgatcgtattacgctgtatatgccgatgattccagagctccccattgtaatg
ctcgccgcctggagaataggcgctgtcacaagcgtcgtattttcaggattctctgccgag
gctttggcagagagaataaacgattcacaatctagaattgtagtaacagtagacggcttc
tggagacgtggaaaggtgataagactaaaggaaatagttgaccaagccttagaaaaggta
ggtaccgtagaaaacgtcattgtatataggagacttggcttaaaagatgtgccaatgaca
gagggtagagactactggtggcataaggtaatggagggtataaaagccaacgcatatgtt
gagccagagcctttagaaagtgaacacccctcgtttattttatacacatccggaacaaca
ggaaagccgaagggcatagtccacgacactggcggttgggcggtacatgtatatgcaaca
atgaagtgggtatttgacctaagagaagaagatatctactggtgtactgcagatatcggg
tgggtcacaggccattcctacgttgtgctagggccgttaatgataggcgctactcaggtc
atatatgaaggcgctcccgattatccacagccagaccgctggtgggctataatagagaga
tacggcgtgacgatactctacacgtcgccaaccgccatacgtatgttcatgcgctacggc
gaggaatggcccaggcgccacgacttatcgaccctgaggattatacactcggttggcgag
cccataaaccccgaggcctggcggtgggcctacaaggtgctcggcaacgaaaacgtggcc
atggcctccacatggtggatgacggagacaggcggtattgttatatctcacacacccggc
ctctatttaatacccatgaagcccggcaccaacggtctgccactccccggcttcgacgta
gatgtgtttgacgacaacggcaagccggcgcccccaggcgtgagagggtacctcgtcata
aagaggccgtggcctggcatgctccacggcatatggggcgaccccgatcgctacataaag
acctactggtctaagtttcccggcgtcttctacgcaggcgactacgcaataaaagaccaa
gacggctacatttgggtcctcggcagggcagacgaggtgataaaagtcgccggccaccgt
ctcggcacatacgagctcgagtccgccctggtgtcgcaccccacagtggctgaggcagct
gtggtgggcgtgcccgaccccatcaagggcgaggtgcccatagctttcgtagtgctgaag
caaggcgtaatgcctagcgacgagctaaggaaagagcttagagaccacgtgaggaagacc
ataggccccgtggcggagcctgcccacatattctttgtgacgaagctccccaagacccgc
tcaggtaagataatgcgccgcctcctaaaggcagtcgccacaggcgcgccactgggagac
accactaccttggaggacgagacgtctgttgaggaggcaaagaaggcctatgaagagctg
aggagagagatcgctagaggatga

DBGET integrated database retrieval system