KEGG   Pyrobaculum islandicum: Pisl_0274Help
Entry
Pisl_0274         CDS       T00444                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pisl_0274
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pisl_0274
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pisl_0274
Enzymes [BR:pis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pisl_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(275294..276505)
Genome map
AA seq 403 aa AA seqDB search
MRGCYVFAYIEKIIKSCFLNRYGGDFGDSSYLRCVNCGAVYASNFRLYRCPKCGGLLDVV
VRDKYWAPKGRGVWRYASMLPLKNGVSLGEGMTPLVKSNLGENLYIKFEGANPTGSFKDR
GMALGVTIAKESGASKVVVASTGNTAASAAAYAARAGLKCYVVLPRGNVARGKLIQAALH
GAELVMVSGLFDKALEYVVTYGTKYAYPLNSFNPWRLEGQKTLAFEIYEELGCPDYVIVP
VGNAGNISAIWKGFKELGELGLCKKLPKMVGVQAEGAAPLATAWQKGLKTPFFIDEPETV
ATAIKIGKPINWPKAMAAVRESEGFFTTVSDGEILKAQKLLASKDGVGSEPAGAASVAAA
LKLKLSGTVVAVVTGHALKDPDVVEINAKEVRNAEELVELLER
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggggtgttatgtcttcgcctatatagaaaagattataaagagctgttttctaaat
cgctatggaggggatttcggggacagttcatatctcaggtgtgtaaactgcggggctgta
tacgcgtcgaactttaggctatatagatgtccaaaatgcgggggacttctcgacgtagtt
gtccgcgataaatactgggctccaaaaggcagaggtgtgtggcgctatgcctcaatgttg
ccgcttaaaaacggcgtttcgctcggcgagggcatgaccccccttgtgaaatcaaaccta
ggcgaaaacttatacatcaagttcgagggggcgaaccccacgggtagttttaaagacaga
ggtatggcccttggcgttactatagctaaagaaagtggcgcgtctaaagtcgttgtagcc
tctactggaaatacggcagcatctgcggcagcgtatgccgcaagagctgggttaaagtgt
tatgttgttttgcccaggggcaatgtggctagaggcaagttgatacaagcggcgttacac
ggcgcagagcttgtaatggtaagcgggttgtttgataaagctttggaatatgtagtgacc
tacggcacaaaatatgcatatcccctcaacagctttaacccctggaggttagaaggtcag
aaaaccctcgcctttgagatatatgaagagctgggctgtccagactatgtaattgtgcct
gttggaaatgctggaaatatttcagcaatctggaaaggctttaaagaactgggagagctc
ggcttatgtaaaaagctcccgaagatggtcggagtacaagcagaaggcgccgcccccttg
gcaacggcgtggcaaaaaggtttaaaaacccccttctttatcgacgagccagagactgtg
gctacggctattaaaattggaaagcctatcaattggcctaaggctatggccgcagtgaga
gagtcagagggctttttcacaactgtgtcagacggcgagattttaaaagcccagaagttg
ctagcgtcaaaagacggagtaggctctgagcccgccggcgcggcttctgtagccgccgcg
cttaaattaaagttaagcgggactgtagtcgccgtggtgacaggacatgcacttaaggac
ccagatgtggtagaaataaatgcaaaagaggtgagaaacgcggaggagttggttgaatta
ttggaaagatga

DBGET integrated database retrieval system