KEGG   Pyrobaculum islandicum: Pisl_0274Help
Entry
Pisl_0274         CDS       T00444                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00260  Glycine, serine and threonine metabolism
pis00750  Vitamin B6 metabolism
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01120  Microbial metabolism in diverse environments
pis01230  Biosynthesis of amino acids
Module
pis_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pisl_0274
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pisl_0274
Enzymes [BR:pis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pisl_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn_ribbon_SprT DZR HypA zinc_ribbon_2 zf-C2H2_11
Motif
Other DBs
NCBI-ProteinID: ABL87453
JGI: Pisl0274
UniProt: A1RR71
Position
complement(275294..276505)
Genome map
AA seq 403 aa AA seqDB search
MRGCYVFAYIEKIIKSCFLNRYGGDFGDSSYLRCVNCGAVYASNFRLYRCPKCGGLLDVV
VRDKYWAPKGRGVWRYASMLPLKNGVSLGEGMTPLVKSNLGENLYIKFEGANPTGSFKDR
GMALGVTIAKESGASKVVVASTGNTAASAAAYAARAGLKCYVVLPRGNVARGKLIQAALH
GAELVMVSGLFDKALEYVVTYGTKYAYPLNSFNPWRLEGQKTLAFEIYEELGCPDYVIVP
VGNAGNISAIWKGFKELGELGLCKKLPKMVGVQAEGAAPLATAWQKGLKTPFFIDEPETV
ATAIKIGKPINWPKAMAAVRESEGFFTTVSDGEILKAQKLLASKDGVGSEPAGAASVAAA
LKLKLSGTVVAVVTGHALKDPDVVEINAKEVRNAEELVELLER
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggggtgttatgtcttcgcctatatagaaaagattataaagagctgttttctaaat
cgctatggaggggatttcggggacagttcatatctcaggtgtgtaaactgcggggctgta
tacgcgtcgaactttaggctatatagatgtccaaaatgcgggggacttctcgacgtagtt
gtccgcgataaatactgggctccaaaaggcagaggtgtgtggcgctatgcctcaatgttg
ccgcttaaaaacggcgtttcgctcggcgagggcatgaccccccttgtgaaatcaaaccta
ggcgaaaacttatacatcaagttcgagggggcgaaccccacgggtagttttaaagacaga
ggtatggcccttggcgttactatagctaaagaaagtggcgcgtctaaagtcgttgtagcc
tctactggaaatacggcagcatctgcggcagcgtatgccgcaagagctgggttaaagtgt
tatgttgttttgcccaggggcaatgtggctagaggcaagttgatacaagcggcgttacac
ggcgcagagcttgtaatggtaagcgggttgtttgataaagctttggaatatgtagtgacc
tacggcacaaaatatgcatatcccctcaacagctttaacccctggaggttagaaggtcag
aaaaccctcgcctttgagatatatgaagagctgggctgtccagactatgtaattgtgcct
gttggaaatgctggaaatatttcagcaatctggaaaggctttaaagaactgggagagctc
ggcttatgtaaaaagctcccgaagatggtcggagtacaagcagaaggcgccgcccccttg
gcaacggcgtggcaaaaaggtttaaaaacccccttctttatcgacgagccagagactgtg
gctacggctattaaaattggaaagcctatcaattggcctaaggctatggccgcagtgaga
gagtcagagggctttttcacaactgtgtcagacggcgagattttaaaagcccagaagttg
ctagcgtcaaaagacggagtaggctctgagcccgccggcgcggcttctgtagccgccgcg
cttaaattaaagttaagcgggactgtagtcgccgtggtgacaggacatgcacttaaggac
ccagatgtggtagaaataaatgcaaaagaggtgagaaacgcggaggagttggttgaatta
ttggaaagatga

DBGET integrated database retrieval system