KEGG   Pyrobaculum islandicum: Pisl_0326Help
Entry
Pisl_0326         CDS       T00444                                 

Definition
thiamine pyrophosphate binding domain-containing protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pisl_0326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_0326
   00020 Citrate cycle (TCA cycle)
    Pisl_0326
   00620 Pyruvate metabolism
    Pisl_0326
   00640 Propanoate metabolism
    Pisl_0326
   00650 Butanoate metabolism
    Pisl_0326
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_0326
   00680 Methane metabolism
    Pisl_0326
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pisl_0326
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pisl_0326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
325633..326643
Genome map
AA seq 336 aa AA seqDB search
MVKTAVKAAEEYEGQYEYATFELPNEELFLPGHGLCAGCTIGVIARHMLKVFGPDTVIIN
PTGCAEVSTVVYPRTNWAVPWIHVAFGNGGSVASGIEAAIKALKRRGVIDPNRRINVVVF
AGDGGTADIGFQALSGMLERGHKVIYVMYDNEGYMNTGIQRSGTTPFGASTTTSPAGKVV
PGNIRHKKPMAAIAAAHGIPYVATANPAYVHDMVYKFKKAMEVNGPSFIHILQSCTPGWR
FEPKYAIRVLELATETGYWVNYEIENGEFRVTLPVPRRKHVKCFLQLQGRFRHLKPDEIE
YIQKVIDRDVEEINRLMGREVIGPLDPSLPCLTERK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaactgcggtgaaggcggctgaggagtacgagggacagtacgaatatgcaacc
tttgagcttccaaatgaggagctcttcctgccagggcatgggctttgcgccggctgtact
atcggagtaattgcaaggcacatgctgaaggtcttcggcccagacaccgtcattataaac
ccgacgggttgcgccgaggtctccacggtggtctacccgcgcaccaactgggccgtgcca
tggatccacgtcgcttttggaaacggcggatcggtggcctctggcatagaggctgcgatc
aaggcattgaagaggagaggcgttattgaccccaataggaggataaacgtggtggtcttc
gccggcgatggagggacagccgacataggcttccaagccctcagcggaatgttggagcgg
ggccataaggtgatttacgtcatgtacgacaacgagggctatatgaacaccggcatacaa
cgtagcgggacaacgcccttcggcgcctctaccaccacctcgcctgcaggcaaggtggtt
cctggcaacataaggcataagaagcccatggcggcgatcgcggccgcccacggcatcccg
tatgtcgctacggcgaatcctgcctacgtgcacgacatggtatacaagtttaagaaggca
atggaggtgaacggcccctccttcatacacatactacaatcctgcacccccggctggcgc
ttcgagccgaagtacgccatcagggtgctggagttggcaacggagaccggctactgggta
aactacgaaatagaaaacggcgaattcagagtcacactgccggtacccaggagaaaacac
gtcaagtgcttcctccagcttcagggcagatttagacaccttaagccagacgagatagag
tacatacagaaagtaattgatcgcgacgtcgaggagataaaccggctcatggggagggaa
gtcataggccccctcgacccttctctgccctgtctcaccgagcggaaatga

DBGET integrated database retrieval system