KEGG   Pyrobaculum islandicum: Pisl_0499Help
Entry
Pisl_0499         CDS       T00444                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00010  Glycolysis / Gluconeogenesis
pis00020  Citrate cycle (TCA cycle)
pis00620  Pyruvate metabolism
pis00633  Nitrotoluene degradation
pis00640  Propanoate metabolism
pis00650  Butanoate metabolism
pis00680  Methane metabolism
pis00720  Carbon fixation pathways in prokaryotes
pis01100  Metabolic pathways
pis01120  Microbial metabolism in diverse environments
pis01130  Biosynthesis of antibiotics
pis01200  Carbon metabolism
Module
pis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
pis_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_0499
   00020 Citrate cycle (TCA cycle)
    Pisl_0499
   00620 Pyruvate metabolism
    Pisl_0499
   00640 Propanoate metabolism
    Pisl_0499
   00650 Butanoate metabolism
    Pisl_0499
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_0499
   00680 Methane metabolism
    Pisl_0499
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pisl_0499
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pisl_0499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABL87677
JGI: Pisl0499
UniProt: A1RRU5
Position
464886..466040
Genome map
AA seq 384 aa AA seqDB search
MKTLSVQKTALTGNYAVAYAVKMAKPHVIAAYPITPQTSIVEKLAEFVERGELNARFVNV
ESEFAAMSVVYGAAMVGARAFTATSSHGLLYMYEVTWWTALSRAPVVMAVVTRTIGPPWN
IHVEHNDILTLRDSGWIIAMAETVQETFDLTIQAFKIAETAILPVAIGVDGFILSHSTEP
VEIPQQEIVDYFLPPRKPDIPLLLRPGEPITFGNLPSDNKIHARHKVSTVYEAHEKAKKI
INHIDEEYGKITGRRYGGLVEWYRAEDAKHIVVCAGAWCSDAKHAVNALRKDGMSIGLMR
LRFIRPFPREEVEKLEDYDTVIIYDRDITPLGGILGIEINSLVSRPKTINIIAGIAGVDF
DSHRFYETIRNAVEGRYRELEFII
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacactttcagtacaaaaaacagctctgacaggaaattatgcagtggcgtatgca
gttaaaatggctaagccgcatgtgatagcggcgtatcctattacaccacagacgtcaatt
gtcgaaaaactcgctgagtttgtagagagaggagagttaaatgcgcgttttgtaaatgtg
gagtcagagttcgccgctatgtctgtggtttatggcgctgcaatggttggcgcgagggct
tttacagcaacttcgtcacacggccttttatatatgtatgaagtcacttggtggactgcg
cttagtagggcgcctgtagttatggccgtagtaacacgtaccatagggcccccttggaat
atccacgtagaacataacgatattctcactctcagagattcaggttggattatagcaatg
gccgagactgtacaagagacctttgatctaacaatacaagcgtttaaaatagcagagacg
gcaattctccccgttgccatcggagtagacggtttcatacttagccactccacagagcct
gtggagataccacaacaagaaatagtggactacttcctaccgccgcgtaaaccagatata
ccgttattactccgccctggggagcctattacatttggtaacttgccctctgacaacaag
attcatgctaggcataaggtatcgacagtatatgaagcacatgagaaggctaagaagatt
atcaaccatattgatgaagaatatggaaaaattacaggcagaagatatggaggacttgtg
gagtggtatagagcagaagatgctaaacacatcgtggtttgcgccggcgcttggtgtagt
gatgctaaacacgcagtcaacgctttaagaaaagacggcatgtctattggtctcatgagg
ctgagattcattagacctttcccaagggaggaggtggaaaagcttgaagattatgatacc
gttatcatatatgacagagatataactcccctcgggggaatcttgggcatcgagattaat
tccctagtctctaggccaaagacaataaacataatagccggtatagcgggcgtagacttt
gatagtcatagattttatgagacgatacgaaatgctgtcgaggggagatacagagaacta
gagttcataatatga

DBGET integrated database retrieval system