KEGG   Pyrobaculum islandicum: Pisl_0500Help
Entry
Pisl_0500         CDS       T00444                                 

Definition
(GenBank) thiamine pyrophosphate enzyme domain protein TPP-binding protein
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00010  Glycolysis / Gluconeogenesis
pis00020  Citrate cycle (TCA cycle)
pis00620  Pyruvate metabolism
pis00633  Nitrotoluene degradation
pis00640  Propanoate metabolism
pis00650  Butanoate metabolism
pis00680  Methane metabolism
pis00720  Carbon fixation pathways in prokaryotes
pis01100  Metabolic pathways
pis01120  Microbial metabolism in diverse environments
pis01130  Biosynthesis of antibiotics
pis01200  Carbon metabolism
Module
pis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
pis_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_0500
   00020 Citrate cycle (TCA cycle)
    Pisl_0500
   00620 Pyruvate metabolism
    Pisl_0500
   00640 Propanoate metabolism
    Pisl_0500
   00650 Butanoate metabolism
    Pisl_0500
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_0500
   00680 Methane metabolism
    Pisl_0500
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pisl_0500
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pisl_0500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-ProteinID: ABL87678
JGI: Pisl0500
UniProt: A1RRU6
Position
466037..466942
Genome map
AA seq 301 aa AA seqDB search
MSFRIDQLPKKKYILPGNAACAGCGMMIGLKVLGMAIGDESVLVIPASCASVVQGLAPKT
GIAIPILNVPFASSAAVATGVAEAFKTLGIKGHVVVWAGDGGTADIGFATLSGAAERNSN
IIYIMYDNEAYMNTGIQRSSSTPRAAWTTTTPAGKRERKKDVALLMAMHGVPYVATASIA
YPQDFYRKLKRATEIDGFKFIHLHTPCPPGWRFDPAKTVEVARLAVETGAWILWEYDHGQ
FRLNPPSTIYADKTKRRPLSEYLKLQGRFAHLTEDDIKALEEDLEDKWQTILALSQSFSR
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcttccgtatagatcagttgccgaagaaaaaatacatactaccaggcaatgcggcg
tgtgctgggtgtggtatgatgataggcttgaaggtcttgggcatggcgattggcgacgag
tctgtgctagtaataccagcgagttgtgcatctgttgtccaaggcctagctccgaaaacc
ggcattgcgatacccattttaaatgtgccatttgcctcttctgccgcagtagctacaggc
gtggcagaagcatttaaaacactcggcataaagggacatgtagttgtatgggctggcgac
ggcggtactgcggatattggttttgcgaccttgagcggtgccgcagagagaaatagtaat
ataatctatatcatgtacgacaacgaggcgtatatgaacacaggcatacaacgtagtagc
tcaacgccgcgcgctgcttggactacaacaactccggctggaaaacgcgagaggaaaaaa
gatgtagccctcctcatggctatgcacggagtgccctacgtagccacggccagtatcgcg
tatccacaagatttctatagaaagctgaagagagctactgagatagacggttttaaattt
atacacctccataccccttgtccccccggctggagatttgaccccgcaaaaaccgtagaa
gttgcaagacttgctgtagagacaggcgcttggatattgtgggaatacgaccacgggcag
tttagattaaacccaccgagtacgatatacgccgataaaacaaagaggaggccattgtcg
gaatatttgaaactacagggtagatttgcccatcttactgaagacgatattaaagcgctg
gaagaagacctagaagataaatggcagactatacttgcgctctcacaatctttctcacgt
cgttaa

DBGET integrated database retrieval system