KEGG   Pyrobaculum islandicum: Pisl_0639Help
Entry
Pisl_0639         CDS       T00444                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pisl_0639
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_0639
  Lipid metabolism
   00071 Fatty acid degradation
    Pisl_0639
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pisl_0639
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pisl_0639
   00626 Naphthalene degradation
    Pisl_0639
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pisl_0639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
583891..584859
Genome map
AA seq 322 aa AA seqDB search
MRAIQLVKFGEPREALKYVELQDPTPGPGEAVVKIEAAGVCGRDLVVRKGAFPHVKPPVI
PGHEGVGRVIDVGAGVEKDLVGMRVFLSAIYDGTCDYCRRGLENLCRNAELLGESRNGTY
AEYVVIPARFVHPFHGVDPKVAVVATCPLATAVYALRQVDVEGKRVLIVGAGGTGVYIAQ
LARVRGAEVYVSTRSVEKAKVLKELGVKIAEDRDKDFDIVIDTVGSPTLEKSFKLAKRAG
TIVVIGNVTGERASISPALIILRQLKVLGSMAFRPWDIYEALDLLKRGLIKPLYTEYRLE
NAPKAHEDMERGAVVGRAVLIP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaattcaacttgttaaatttggagagcctagggaggctcttaaatatgtggaa
ttgcaagatccaacgccaggccctggggaggctgtagtgaagatcgaagccgcaggcgtt
tgtggccgagatcttgtcgtgcgtaaaggcgcttttccgcatgtaaaaccgccagttata
cctggccatgagggagttggcagagtgattgatgtaggcgctggtgttgaaaaggactta
gtaggtatgagggtatttctctcggctatttatgacggcacatgtgattattgcagaagg
gggctagagaatttatgtagaaatgcagaactacttggcgaatctcgtaatggcacatat
gccgaatatgtagttattccagcgagatttgtgcatccattccatggcgtagatccaaaa
gtagctgtagtagcgacatgtccgcttgctactgctgtttatgcgttaaggcaggtggat
gtggaagggaagagagtattgatagtaggcgccggcggcactggggtttatatagcacaa
ctagctcgtgtaagaggagctgaggtctatgtatcaactaggtctgttgagaaagcgaaa
gtgttaaaagagcttggtgttaaaatagctgaagacagagataaagactttgacatagtt
atagacacagtgggcagccccactcttgaaaaatcgtttaaacttgccaaaagagctgga
actatagttgttattggtaatgtcacaggcgagcgtgcttcaataagccctgcattgatt
atcctgcggcaattaaaggtgttgggtagtatggctttcaggccatgggatatttatgag
gcactagatttattaaagagggggcttataaagcccctttatacagaatataggctagag
aacgctccaaaagctcatgaagatatggagagaggtgcagtagttggaagagcagtttta
attccctga

DBGET integrated database retrieval system