KEGG   Pyrobaculum islandicum: Pisl_0738Help
Entry
Pisl_0738         CDS       T00444                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pis  Pyrobaculum islandicum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pis01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pis00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(667639..669483)
Genome map
AA seq 614 aa AA seqDB search
MVVFRVIRVDLSTEKITEEVYKEDVLRKFLGGRGLGSYLALKEIPRGIDPFSPSNKLYIF
TGPLSGLATLATSRVTVVTKSPLTGSLTHSNAGGNFAYMLRRAGYDGIIVEGKAEEPVYI
LIKEGEVSIRPAKHIWGKWTGAATKALLEDAGFEGDERKAGVATIGPAGENLSRIAGIRF
SDYERFAGRGGVGAVMGSKRLKGIVAWGTRDLYSLVVDRKKWIEETSKLAQRIANGPTAK
TLHTYGTNILMNIINSVGGLPTRNFETGYFEEAEKISGEYIKQNYVVEVHGCAQCPIACT
QMVEVKSGPYKFIGKAKYEYENTWALGANLGVGNPEADLKLQKLANELGFDTISLGNTLA
VAIELAKKGKLNIPLEWGDPTPLIDLVYKMAYRDGIGDELAEGDYRLAMKYGEPEAFVGS
RGQGFPAYDPRALKSFAIAYVTANRGGDHLEAYGPTWEVLGVPEKVDPLCETSECIKKKV
ELVVYAQHLMALADSVTFCKFATLDKEGLFEKDLAHLFNLAFGWDVTPEEMLMIGERIFN
IERLFHVKEGRWVRDELPPRLRKELPTGPAKGHGALKTFEEGIKEYYAIRGWVDGKPTYE
TLKRLGLEEFQYLL
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggttgtatttagagtaatacgagtagatctatctaccgagaaaataacagaagaggtg
tataaggaagacgtcttgaggaagttcctaggcgggagaggattaggctcttacctagct
ctgaaggagatcccccgggggatagatccgttttcgcctagtaataaactttacatattc
accggacccctaagtggtttggcaacacttgccacgagcagggtaactgtcgttacaaaa
tcccccttgacaggatctcttacacactcaaacgccggaggtaattttgcatacatgttg
aggagggctggctatgatggcattatagtagagggtaaggcagaggagccagtctatata
ttgattaaagagggtgaagtaagtataaggccagctaagcacatttggggcaagtggacg
ggcgcagcgacaaaggctttgcttgaagacgccggatttgaaggcgatgagcgtaaggca
ggcgtggccactataggcccagctggcgagaatctgtcgagaatagccggcattagattc
agtgattatgagcgttttgccggaagaggcggcgtaggggctgtcatgggctcgaaaaga
ctcaaggggatagtggcatggggtacccgcgacttgtactcactagttgtagacagaaag
aaatggatagaagaaactagtaagctagcgcagagaatagcaaatgggcctactgctaag
acgttacatacctatggtactaacatacttatgaatatcataaattcagtggggggactt
cctacgcggaattttgaaactgggtattttgaagaagcagagaagatatctggtgagtat
atcaaacagaactatgttgttgaagtacacggctgtgcccaatgtcccattgcatgtaca
cagatggtagaggtgaagtccggcccgtacaagttcatcggcaaggctaagtatgagtat
gaaaatacatgggctctcggcgcaaatctcggagttggaaatccagaggctgatttaaaa
ctacagaagttagcaaacgaattggggtttgacacaatttctcttggcaacaccctagct
gttgcaatagaactcgccaagaagggcaagttaaacataccgctggagtggggcgaccca
actccgcttattgacttagtctacaagatggcgtatagagacggcataggcgacgagttg
gcagaaggcgattatagacttgctatgaaatatggtgagccagaggcctttgtcggatct
agaggacagggcttcccagcctacgatccaagagcacttaagagctttgcaattgcgtat
gttactgcaaaccgcggcggcgaccatctcgaggcctacggacccacttgggaggtcctc
ggcgtgccggagaaggtcgatccgctttgtgaaacgtcagagtgtataaagaagaaagtg
gagcttgttgtatatgcccaacacttaatggcgcttgcagactctgtaacattttgcaaa
tttgccacattagataaagaggggttgtttgaaaaagaccttgcacatttatttaatctg
gcgtttggatgggatgtaacgcctgaggagatgcttatgataggcgagcgtatatttaac
atagagaggctgtttcatgtaaaagaggggaggtgggtaagagacgaactgccacctagg
ttgaggaaagagcttcccacgggcccggctaagggccacggcgcattaaagacatttgaa
gaggggataaaggaatattacgcaataaggggctgggtcgatgggaagccgacttatgaa
actttgaagagacttggtctagaggagtttcagtaccttttgtaa

DBGET integrated database retrieval system