KEGG   Pyrobaculum islandicum: Pisl_0939Help
Entry
Pisl_0939         CDS       T00444                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pis  Pyrobaculum islandicum
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Pisl_0939
Enzymes [BR:pis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Pisl_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
835892..836449
Genome map
AA seq 185 aa AA seqDB search
MEIEEEFLRYVRLLYERGHLTLLSGNVSVRAGNRVLVTPTSRPKPFLTVDDLVWIDLEGR
VIKGRLMPTSEWRMHVAVYKRRGDVNAVVHTHDVLPIILADKLDSSLLSEAEIYLGSEIA
IVEYFQPGTVELAESVAKALERNNVAILKRHGVVAVGRDLAEAVNRVETLVDLAKAVFYK
QLLEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggagatagaggaggagtttctaaggtacgtacgcctactttacgaaagaggtcactta
actctcttgtcaggcaatgtctcggttcgtgcgggaaatagagtattagtgacgcctacg
tcacgtccaaagccgtttctcacagtcgacgacttagtctggatagacttagagggcaga
gttattaaaggtcgtctaatgccgacaagcgagtggcgaatgcatgtggcagtatataag
agacggggcgatgtaaacgccgtagtgcatacacacgacgtcttacctataattctcgcc
gataagttagacagttcgcttctttcagaagctgagatatatctcggctcagaaatagct
atagtggagtatttccaacctggcaccgtagagttggcagaaagtgttgcaaaagcacta
gaaagaaataatgtagctattttaaaacgccacggagtagtagctgtaggtagagactta
gctgaggcagtaaatagagtagagaccctagtagacttagccaaggctgtgttttacaaa
caacttttggagttatga

DBGET integrated database retrieval system