KEGG   Pyrobaculum islandicum: Pisl_0979Help
Entry
Pisl_0979         CDS       T00444                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pisl_0979
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_0979
   00052 Galactose metabolism
    Pisl_0979
   00500 Starch and sucrose metabolism
    Pisl_0979
   00520 Amino sugar and nucleotide sugar metabolism
    Pisl_0979
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pisl_0979
   00524 Butirosin and neomycin biosynthesis
    Pisl_0979
Enzymes [BR:pis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pisl_0979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(876939..877886)
Genome map
AA seq 315 aa AA seqDB search
MGKFFYSALKQVYVRLFLGIDIGATWTRALLIDEHGDIINRVKVKTSVNPIADVVDIVKR
WQFHAVGVGSIGPLDLKSGWVVNSPNSPTRRFPLVEPLKELGKPIVVANDCVAAVWGEYV
FKYNVENMVYITLSTGVGVGAIVNGNLLLGKDGNAHELGHAVIDFKSARRCGCGGRGHFE
AYVGGAHIPRVYQEATGDAPASPEEIFRRYRHGDEKARKFINLWLDALAAGIATVVAAYD
PELLIVGGSIALNNWDIISRELPARLRDYLSLREPEILKASFGDDEVAVGAAALAYKTPD
TLKKFGYPITASSQS
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgggcaaatttttttattcagcgctgaaacaagtatatgtgcgtctatttcttggaata
gatataggagctacttggactagggctttattaatagacgaacatggtgatataataaat
agagttaaagttaaaactagtgtaaatcctattgctgatgttgttgatatagtaaagcga
tggcaatttcacgccgtgggagtagggtctatagggccgctggatcttaagagcgggtgg
gttgtaaattcgccaaactccccaacgcgtagatttccactggtggaacctttaaaagag
cttggaaaacctatagtagttgccaacgattgtgtagcagctgtatggggcgaatacgtg
tttaagtataatgttgaaaatatggtttatataacgctatctactggagttggcgtaggc
gctatagtaaatggtaatttgctattgggcaaagatggtaatgcccatgagcttggacat
gcggttatagactttaaatcggcgaggagatgcggctgtggggggcgtggccattttgaa
gcttatgtgggcggcgcgcatatacctagggtttatcaagaggctactggcgacgctccg
gcaagcccagaggaaatatttagaaggtatagacatggcgacgaaaaagccagaaagttt
ataaatctatggctagacgcgttagccgccggaattgctactgtcgtagctgcctacgac
cccgaattgctcatagtagggggctctatagcgttgaacaattgggacataatatcgcgt
gaactccccgctaggctaagggattatctaagcctacgagagccagaaattttaaaggcc
tcttttggagatgatgaagtagctgtaggtgcagctgctttagcctataaaacacctgat
actttaaagaagttcggataccccattacggcctcttcccagtcttag

DBGET integrated database retrieval system