KEGG   Pyrobaculum islandicum: Pisl_1026Help
Entry
Pisl_1026         CDS       T00444                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pis  Pyrobaculum islandicum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pisl_1026
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pisl_1026
   00640 Propanoate metabolism
    Pisl_1026
   00660 C5-Branched dibasic acid metabolism
    Pisl_1026
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_1026
Enzymes [BR:pis01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pisl_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
925430..926578
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFLRYGVKIPPGKLALTPDEVRKIAEEIGTPVVLKAQVVVAGRGKAGGIK
IAQTPEEAYELSKKMFGMNIKGLVVRKLYVTKYVEVEREMYLSLIIDRASRRYLFLASPI
GGVDIEEIAKTSPEKIKKVYVDPSIGLRDYHIRSIISWLGFKPGSQQWQQTASVIQAMYR
IMVDYDAELVETNPLALSKEGEVIPLDARVIVDDNALFKHPDLEKALEEDPRDITEFEAY
AKKIGFHYVELDGDIGIIGNGAGLTMATMDLVYHFGGRPANFLDIGGGASREVVKEAVKV
LLNHPRVKVIFVNIFGGITRADEVALGIKDALAEVKEHTKKIVVRIKGTNEEQGKAILSE
IGIPLFENAEEAAKKAVELAKI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgaatatgaggctaaagagctcttcctaagatatggagttaaaataccc
cctggcaaattagccctaactccagatgaggtacgcaaaatcgcagaggaaataggcacg
cctgtagttttaaaggcacaggtagttgtagcaggcaggggtaaggcaggcggtataaag
atagctcagaccccagaggaggcatatgaactttcaaaaaagatgtttggcatgaacata
aaggggcttgtagtgaggaagctttatgtgactaaatacgtagaggtcgaacgggagatg
tacctttcgcttatcatcgatagagcttctcgtagatatctattcctagcctctccaata
ggtggggtagacatcgaggaaatagccaaaacaagcccagaaaagattaagaaggtatat
gtggatccctctattggtttaagagactatcacattaggtctataatatcatggctcggc
tttaaacctgggtcgcaacagtggcaacaaaccgcttcagttatacaagcaatgtataga
ataatggtagattatgacgctgagctagttgagacgaacccgcttgcgttatcaaaagag
ggcgaggtaataccccttgatgcaagggtgatagttgacgacaacgctctctttaaacac
ccagatcttgagaaggcgttggaagaggatccacgtgatataacagaatttgaggcgtat
gcaaaaaagataggatttcactatgtggaattagatggagatattggaattattggaaac
ggcgctggtttgaccatggcgacaatggatctcgtatatcacttcggcggtagacctgcg
aactttctcgatataggcggtggcgcaagtagagaagttgttaaggaggccgtcaaagta
ttgcttaaccatcccagggtcaaagttatatttgtcaacatatttggaggaataacgcgt
gcagatgaggtagcgctgggcataaaagatgcgcttgcagaggttaaagaacatacaaag
aaaattgtagtgagaataaagggcacaaatgaggaacagggcaaggcaatactctcagaa
attggaataccgttgtttgaaaacgcagaggaggcggcaaaaaaagctgtagaattggcg
aagatatga

DBGET integrated database retrieval system