KEGG   Pyrobaculum islandicum: Pisl_1026Help
Entry
Pisl_1026         CDS       T00444                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pis  Pyrobaculum islandicum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pisl_1026 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pisl_1026 (sucC)
   00640 Propanoate metabolism
    Pisl_1026 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Pisl_1026 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_1026 (sucC)
Enzymes [BR:pis01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pisl_1026 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
925430..926578
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFLRYGVKIPPGKLALTPDEVRKIAEEIGTPVVLKAQVVVAGRGKAGGIK
IAQTPEEAYELSKKMFGMNIKGLVVRKLYVTKYVEVEREMYLSLIIDRASRRYLFLASPI
GGVDIEEIAKTSPEKIKKVYVDPSIGLRDYHIRSIISWLGFKPGSQQWQQTASVIQAMYR
IMVDYDAELVETNPLALSKEGEVIPLDARVIVDDNALFKHPDLEKALEEDPRDITEFEAY
AKKIGFHYVELDGDIGIIGNGAGLTMATMDLVYHFGGRPANFLDIGGGASREVVKEAVKV
LLNHPRVKVIFVNIFGGITRADEVALGIKDALAEVKEHTKKIVVRIKGTNEEQGKAILSE
IGIPLFENAEEAAKKAVELAKI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgaatatgaggctaaagagctcttcctaagatatggagttaaaataccc
cctggcaaattagccctaactccagatgaggtacgcaaaatcgcagaggaaataggcacg
cctgtagttttaaaggcacaggtagttgtagcaggcaggggtaaggcaggcggtataaag
atagctcagaccccagaggaggcatatgaactttcaaaaaagatgtttggcatgaacata
aaggggcttgtagtgaggaagctttatgtgactaaatacgtagaggtcgaacgggagatg
tacctttcgcttatcatcgatagagcttctcgtagatatctattcctagcctctccaata
ggtggggtagacatcgaggaaatagccaaaacaagcccagaaaagattaagaaggtatat
gtggatccctctattggtttaagagactatcacattaggtctataatatcatggctcggc
tttaaacctgggtcgcaacagtggcaacaaaccgcttcagttatacaagcaatgtataga
ataatggtagattatgacgctgagctagttgagacgaacccgcttgcgttatcaaaagag
ggcgaggtaataccccttgatgcaagggtgatagttgacgacaacgctctctttaaacac
ccagatcttgagaaggcgttggaagaggatccacgtgatataacagaatttgaggcgtat
gcaaaaaagataggatttcactatgtggaattagatggagatattggaattattggaaac
ggcgctggtttgaccatggcgacaatggatctcgtatatcacttcggcggtagacctgcg
aactttctcgatataggcggtggcgcaagtagagaagttgttaaggaggccgtcaaagta
ttgcttaaccatcccagggtcaaagttatatttgtcaacatatttggaggaataacgcgt
gcagatgaggtagcgctgggcataaaagatgcgcttgcagaggttaaagaacatacaaag
aaaattgtagtgagaataaagggcacaaatgaggaacagggcaaggcaatactctcagaa
attggaataccgttgtttgaaaacgcagaggaggcggcaaaaaaagctgtagaattggcg
aagatatga

DBGET integrated database retrieval system