KEGG   Pyrobaculum islandicum: Pisl_1026Help
Entry
Pisl_1026         CDS       T00444                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00020  Citrate cycle (TCA cycle)
pis00640  Propanoate metabolism
pis00660  C5-Branched dibasic acid metabolism
pis00720  Carbon fixation pathways in prokaryotes
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01120  Microbial metabolism in diverse environments
pis01130  Biosynthesis of antibiotics
pis01200  Carbon metabolism
Module
pis_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pis_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pis_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pisl_1026
   00640 Propanoate metabolism
    Pisl_1026
   00660 C5-Branched dibasic acid metabolism
    Pisl_1026
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_1026
Enzymes [BR:pis01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pisl_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABL88200
JGI: Pisl1026
UniProt: A1RTB8
Position
925430..926578
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFLRYGVKIPPGKLALTPDEVRKIAEEIGTPVVLKAQVVVAGRGKAGGIK
IAQTPEEAYELSKKMFGMNIKGLVVRKLYVTKYVEVEREMYLSLIIDRASRRYLFLASPI
GGVDIEEIAKTSPEKIKKVYVDPSIGLRDYHIRSIISWLGFKPGSQQWQQTASVIQAMYR
IMVDYDAELVETNPLALSKEGEVIPLDARVIVDDNALFKHPDLEKALEEDPRDITEFEAY
AKKIGFHYVELDGDIGIIGNGAGLTMATMDLVYHFGGRPANFLDIGGGASREVVKEAVKV
LLNHPRVKVIFVNIFGGITRADEVALGIKDALAEVKEHTKKIVVRIKGTNEEQGKAILSE
IGIPLFENAEEAAKKAVELAKI
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacatgaatatgaggctaaagagctcttcctaagatatggagttaaaataccc
cctggcaaattagccctaactccagatgaggtacgcaaaatcgcagaggaaataggcacg
cctgtagttttaaaggcacaggtagttgtagcaggcaggggtaaggcaggcggtataaag
atagctcagaccccagaggaggcatatgaactttcaaaaaagatgtttggcatgaacata
aaggggcttgtagtgaggaagctttatgtgactaaatacgtagaggtcgaacgggagatg
tacctttcgcttatcatcgatagagcttctcgtagatatctattcctagcctctccaata
ggtggggtagacatcgaggaaatagccaaaacaagcccagaaaagattaagaaggtatat
gtggatccctctattggtttaagagactatcacattaggtctataatatcatggctcggc
tttaaacctgggtcgcaacagtggcaacaaaccgcttcagttatacaagcaatgtataga
ataatggtagattatgacgctgagctagttgagacgaacccgcttgcgttatcaaaagag
ggcgaggtaataccccttgatgcaagggtgatagttgacgacaacgctctctttaaacac
ccagatcttgagaaggcgttggaagaggatccacgtgatataacagaatttgaggcgtat
gcaaaaaagataggatttcactatgtggaattagatggagatattggaattattggaaac
ggcgctggtttgaccatggcgacaatggatctcgtatatcacttcggcggtagacctgcg
aactttctcgatataggcggtggcgcaagtagagaagttgttaaggaggccgtcaaagta
ttgcttaaccatcccagggtcaaagttatatttgtcaacatatttggaggaataacgcgt
gcagatgaggtagcgctgggcataaaagatgcgcttgcagaggttaaagaacatacaaag
aaaattgtagtgagaataaagggcacaaatgaggaacagggcaaggcaatactctcagaa
attggaataccgttgtttgaaaacgcagaggaggcggcaaaaaaagctgtagaattggcg
aagatatga

DBGET integrated database retrieval system