KEGG   Pyrobaculum islandicum: Pisl_1066Help
Entry
Pisl_1066         CDS       T00444                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pis  Pyrobaculum islandicum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pis00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pis00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
960230..961144
Genome map
AA seq 304 aa AA seqDB search
MWRGRDVISARDFNRVDLEELFEMAKYMEKYAKSRVEFLKGKIMAVAFFEPSTRTRLSFE
VAMKRLGGDVIGFWGAEGTSVEKGETLADTIRMLDAYSDIIVIRHKYEGAAKLAAEVAES
PVINAGDGAYNHPTQAMLDVYTIWREFGTVDGLNIGLLGDLRHARTINSLLEILTNFKVR
VYLISPELLRPRVETINYIQSRGLMLSFHTNIEEVIHELDVVYVVRIQKERFIDPLEYER
IKGSYKITLDTLKNVKKNLIILHPLPRVDEIDHRVDSTPYAKYFRQAAFGVPLRMALLYL
ILQP
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtgggagagatgtgatatctgcacgcgacttcaatagagtagatctagaggag
ctatttgaaatggctaaatatatggagaagtatgctaaaagtcgtgtcgagtttttaaag
ggcaaaattatggctgtggcgtttttcgaaccttctacacgtactaggctgagttttgaa
gtagcaatgaagagattgggcggagatgtcattggattctggggggctgaaggcacaagc
gtagaaaagggcgaaactcttgcagatactataagaatgttagacgcatactctgacata
attgtcataagacataagtatgagggagcggctaagcttgctgcagaagttgcagaaagt
cctgtaattaacgccggcgacggcgcctataaccacccgacacaagccatgttagatgta
tataccatatggagagagtttggcacagtggatggattaaatataggtctcctaggcgac
ttacgtcatgcacgtactataaacagcctccttgaaatacttacaaatttcaaagtgaga
gtttatctaatctctcccgaacttctccgccctagggtagagacgataaactacatccaa
tctaggggattaatgctaagttttcatacaaacatagaggaggttatacatgagctcgac
gttgtatatgtagtaaggattcaaaaagagcggtttattgacccattggaatatgaaaga
ataaaggggagctacaaaataacactagatactttgaaaaacgtaaagaagaatctcata
atacttcaccctctgccacgtgtagatgaaatagaccatagagtagattcaacgccgtat
gcaaaatactttagacaggcggcgtttggggttcccctgaggatggcacttctatacctt
attctacagccgtga

DBGET integrated database retrieval system