KEGG   Pyrobaculum islandicum: Pisl_1117Help
Entry
Pisl_1117         CDS       T00444                                 

Definition
ribokinase-like domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
pis  Pyrobaculum islandicum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pisl_1117
Enzymes [BR:pis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pisl_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1015885..1016802
Genome map
AA seq 305 aa AA seqDB search
MDVVSVGNLNFDIYLKVSELPGPDENVEVLDLYTGGGGSAANFSVAAARLGLGVRFIGAV
GEDPLGELSLRELRSEGVDVSYVKRVAGVRSGVVIVLVHPDGVKRMLSYRGANLGLSPAD
LTIEKFRGFRHIHLATGRTELILKAKEIAKEIGATVSLDGGTALAKKGLDIVKAVVNGID
IVFMNQVEAKLLANSHDHKTAVEKLAKELSVRELVVTLGPRGAVAFDGRRLLHVDAFKLD
AVDTTGAGDCFAAAYVAMYLRGRDLYEKLLFANAAAAIKVTRPGARSSPRYSEVVAFLES
LGYKI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtggacgtagtatcagttggaaatttaaacttcgacatatatctcaaagtttctgaactg
ccagggcctgacgaaaatgtagaagtcctcgatttatacacaggcgggggaggctcggcg
gctaatttctctgtcgcggcggctaggctggggcttggcgttagatttataggcgcagtc
ggcgaagacccgctaggtgagctatcgctaagagagctgaggtctgagggcgttgatgtc
tcctatgtgaaaagagtggctggcgtaagatctggcgtagttattgtgttagtacacccc
gacggggtaaaaagaatgttgtcgtatagaggcgcaaacctaggcctatctccagccgat
ttgacaatagaaaaattccgcggcttccgacatatacatttagctacaggaaggacagag
cttattctaaaggcgaaggaaattgctaaagaaataggagccacagtgtcattagatggg
gggactgctcttgcgaaaaaaggccttgatatagttaaagctgttgtaaatggcatagat
atagtctttatgaatcaggtagaggctaagttacttgctaattcacatgaccacaagacg
gcagttgaaaaacttgcaaaggagctttctgtaagagagcttgtagtgaccctggggcct
aggggcgcggtggcttttgacggcaggagactactacatgtagacgcctttaagttagac
gctgtggatacaacaggggcgggggactgtttcgccgccgcttatgtagccatgtatcta
agggggagagatctatatgaaaaactgctctttgctaacgcagccgccgctataaaagta
actaggccgggggcgcggtcttctccccgctatagcgaagttgtcgcttttctagagtcg
cttggctacaagatttaa

DBGET integrated database retrieval system