KEGG   Pyrobaculum islandicum: Pisl_1167Help
Entry
Pisl_1167         CDS       T00444                                 

Definition
radical SAM domain-containing protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
pis  Pyrobaculum islandicum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1057702..1059111
Genome map
AA seq 469 aa AA seqDB search
MEKPLRFIRMASGVHVVAVMTHPFPCPGRCSFCPSAAGVPKSYMPDSPVVLRAGRSGFDP
YRQVVGRVKVYLDNGHMPSKVEVVVMGGTFSALPRWYREWFIGNVFKALNDYPSWAAGAD
PSPDLELEQRRNEGARIRLVALTVETRPDYVDVGEVDFLLRLGVTRVELGVQSIYDDVLA
RVDRGHGVAEVVRATALLKDSAYKVCYHLMPGLPGSDPDRDLEMFREVFSNPDFMPDCVK
IYPTYVVPGTRLYEEWRRGGYRSYGEDTWLDLLAKIYASVPRWARVMRLGRDIPLHHVVD
GPRWGNMRQVVLKRMEQLGLKCVEIRCREVGIKLANGVYVEPGPVEIKRHIYEASRGVEV
FLEAVGPDDTLYGILRLRMPYKPHRPELVGQTALVREIHVYGPEVPVGEEGVWWQHVGIG
RSLMERAEEIAALEFSAKKVAVISGVGARPYFRKLGYERCGPYMCKELR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaagcctctgcggtttattaggatggccagtggggttcacgtagttgccgtgatg
acgcatccctttccctgcccggggaggtgtagcttttgcccctctgcggctggggttccc
aagtcgtatatgccggatagtccggtggttttgagggctgggcgtagtggttttgacccc
taccggcaggtggtggggcgggtgaaggtgtatctcgacaacggccacatgccctctaag
gtggaggtggtggttatgggcgggaccttctcggctttgcctaggtggtatagggagtgg
tttattggcaacgtgtttaaggctctcaacgactaccccagctgggcggctggggccgac
ccttcgcctgacctcgagcttgagcagcggcgtaacgagggggcgcggatccggctggtg
gctttgactgtggagacgcgccccgactacgtcgacgtgggagaggtggacttcctcctt
aggcttggggtgacgcgggtagagctgggagtccagtctatctacgacgacgtgttggcc
cgggtcgatagaggccacggcgttgccgaggtggtgagagccacggcgcttctgaaggac
tcggcgtataaggtgtgttaccacctaatgccggggctccccggaagcgacccggaccgc
gacctggagatgtttagggaggttttttcaaatccagacttcatgccggactgcgtcaag
atatatcccacgtacgtcgtccccgggacgaggctgtatgaggagtggaggcggggcggc
tataggagctacggcgaggatacgtggctcgatctgttggcgaaaatctacgcctctgtg
ccgaggtgggccagggttatgaggctggggagggatatacctctgcaccatgtcgtcgac
ggcccgaggtggggcaatatgagacaggtggtgcttaagcggatggagcagctaggtctt
aaatgtgtcgaaataaggtgtagagaggttggcataaagcttgccaacggcgtttacgta
gagccggggcctgtggaaataaagagacatatctatgaagcttctcgcggcgtggaggtc
tttttagaggctgtggggccggacgacactctatatggcatacttaggctgaggatgccg
tataagccgcataggccggagctcgttgggcagacggcgttggtgagagaaatacatgta
tatggcccagaggtgccggtgggggaggagggggtctggtggcagcacgtgggcataggc
agatctctcatggagagggctgaggaaattgccgcgttggagttctcagcaaagaaagtc
gctgtgataagcggcgtgggggccaggccctacttcaggaagctcggctatgagagatgt
ggcccctacatgtgtaaagagcttagataa

DBGET integrated database retrieval system