KEGG   Pyrobaculum islandicum: Pisl_1215Help
Entry
Pisl_1215         CDS       T00444                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pis  Pyrobaculum islandicum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pis01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pis00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1100424..1101533)
Genome map
AA seq 369 aa AA seqDB search
MRRILPRDVVKSVEEIVDDVTERGLQAALEYSRRFDGVVPERALLEPRPGGDPDVVAAAL
EVAKSLEMLYSKLKPPEAVDFYGGVLRSVFWRPVRSVALYVPARYVSTLVMLAVPARAAG
VEKIYVVTPPKGATGELLAVAKELDVAGVIPIGGPHGLAYAVFHMGVDMVAGPGGLYVQA
AKYVLSLHVGIDGIEGPTELVVYAEGVPPEKAVAGALAQLEHGPTSFAYLVSTDSGLLEA
AAEIYRRERTSSMGPLEVRKVHDVEEAVRLIDSIAPEHLEVWGAREVAYRVRNVGAVSVN
MPSPYLDYAAGISHVLPTGGSARWRGIITPATFMKPIGVAEAVGRLELLEAARRLAEYEG
FRYHRQALA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgcattctccctcgcgacgtggtaaagtctgtggaggagatagtagacgacgta
acggagagggggctacaggcggccctggagtactcaaggcgttttgacggcgttgtgcca
gagagagccctcctagaacccaggcccggcggagatccagacgtggtggctgcagcgctg
gaggtggccaaatccctagagatgctctacagtaagctcaagccgcccgaggctgtagat
ttctacggcggcgttctcaggtcggtcttctggagaccggtgaggtcggtggctctctac
gtcccggctagatatgtgtcgactctcgtgatgcttgcagtccctgcaagggcagccggc
gttgagaagatatacgtcgtcaccccgcccaagggcgccaccggcgagctccttgccgtg
gcgaaggagcttgacgttgccggcgtgatccccatcggaggcccacacggtctcgcctac
gccgtatttcacatgggcgtagacatggtggcggggcccggggggctctatgtccaagcg
gctaagtacgtattgtctctacacgtgggtatcgacggcatagaggggccgacagagctt
gtggtatatgcagagggggttccgccggagaaggcggtggccggggcgttggcgcaacta
gagcacggccccacctccttcgcctacctagtctcaacagacagcggactgctggaggcc
gccgccgagatatacagacgcgagagaacctcctccatgggacctctcgaggttagaaag
gtccacgatgtagaagaggcggtgaggctcatagactcgatagcccctgagcatctcgag
gtgtggggcgccagggaggtggcgtaccgcgtgagaaacgtgggagctgtctcagtaaat
atgccgagcccctaccttgactacgccgccggcataagccacgtgttgcccaccgggggt
tcggccaggtggcgtgggataattacgcccgccactttcatgaagccaatcggcgtggcg
gaggctgtgggacgtttagagcttctagaggccgccagaaggttggcggagtatgaaggc
ttcagataccacagacaagcgttagcatga

DBGET integrated database retrieval system