KEGG   Pyrobaculum islandicum: Pisl_1226Help
Entry
Pisl_1226         CDS       T00444                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:pis01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pis01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pis00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1109677..1111536
Genome map
AA seq 619 aa AA seqDB search
MLLLTIDVGSQKVGKKELNVSGILEIALTVHKEAESWRLDPLSPEAPVVFGFGPFVGGRL
YGVHRLVFVFKSPQTKTLHISAIGGVAYKAMGMGAQAVSIVGKAERPIALFIANGDVKFI
EVNPSDAYETARQLYERYIDFFKQYDARALVVGPAAYTTYNGAVISIDIDVKKGEFKLGA
EDFAARGGPGTALAQGHNVAAIVLGGFKKPLYEKISDPEAIDKIFLYKFGKRYIDVVQEK
TIKYRFDPKLGTGGTFGVNYLHYRDLLPLFGYKSIYMSKEERIKHADLIVELFWRPFQRE
VFEKSKSWYNCGEPCPVVCKKVWRGKKVDYESFHAAGPFIGNYLFEEAVPLVDKIDRLGL
DAIETGHIVAWLFDAVYVGLLKPEEVGIDEIPAFDPQSFNPVEDSRKNARLAIKLVENFV
NNTTEVLSLVAKYGIRKAARELERKFHDRVVTTGHRFRDLAVYAAYGTEGYMTPNFYWAP
GLVAPMYIQGRYWTNYNPTFMAPEDFAKSSYERAVAEAYIDNAGICRFHRGWAEPVLKEL
YTLVGLDPPTPEIYRGFAQYAKLAGAEPMPWESKRARDLVSTLARELGSKEWQFQDYDDY
YEWWIRFKDALDKLISGGA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgttattattaacaatagacgttggaagtcagaaggtaggtaaaaaagagcttaatgtc
tccggtattcttgaaatagcgttaacagtacataaagaggcagagtcatggcgcttagac
cccctatctcctgaagcccccgtggtattcggcttcggccctttcgtaggcggaagacta
tacggagtacacagacttgtgtttgtatttaaaagcccgcagacaaagactcttcatata
tctgctataggcggcgttgcatataaagcgatgggcatgggcgctcaagccgtttctatt
gtcggaaaggcggagaggccgatcgctttgtttattgcaaacggcgatgtgaaatttata
gaggtaaacccaagcgatgcatatgaaacagctagacaattatacgagcgctatatagac
ttttttaaacaatatgatgcgagagcgcttgtcgtaggacctgcggcatataccacatac
aacggcgctgttatatctatagatatagacgttaaaaaaggtgagtttaaactaggcgcg
gaagactttgccgcgcgaggcggcccaggcacggcgcttgcccaagggcacaacgttgca
gcaattgtgttggggggctttaaaaagccgttgtatgaaaaaatatcagatccagaggct
atagacaagatatttctctataagtttggaaaacgttatatcgatgttgtacaagagaag
actattaaatatagattcgacccgaagctagggacgggaggcacctttggcgtaaattat
ctacactaccgcgaccttctcccccttttcggctataaatccatatatatgtctaaggag
gagagaataaaacatgcggacttgatagtagagctgttctggaggcccttccagagagag
gtatttgaaaaatcaaaaagttggtataactgcggagagccctgtccagtcgtctgtaaa
aaagtgtggcgcggcaagaaggtcgactatgagtcattccacgccgccgggcccttcata
ggcaactacctatttgaagaggctgttcctctcgtcgataagatagatagactcggtcta
gacgccatagagactggacatatagttgcctggctctttgacgccgtatatgtaggcctt
ttaaagccagaagaggtgggcatagacgaaattccagcatttgacccacagagttttaac
ccggtggaggactctagaaaaaacgcccggcttgcgataaagcttgtggaaaattttgta
aataacactaccgaggtgttgtcgcttgttgcaaagtacggaattaggaaggccgcgcgg
gagttagaaagaaaatttcacgacagagtagtaactactggccataggtttagagacctt
gcagtatatgcggcatatggtaccgaggggtatatgacgcctaacttctactgggcgccc
ggcctagtggcgccgatgtatatacaaggccgctactggacaaactacaaccccaccttc
atggcgcctgaggacttcgcaaagtcatcttacgagagggcggtggccgaggcctatata
gacaacgcagggatatgtagattccaccgcggatgggcagagcccgtgttgaaagagcta
tacacactcgtgggtctcgaccccccgacccctgagatctacagagggtttgcccagtat
gcgaagttagcaggggcagagcccatgccctgggagagcaaaagggcgagagacctcgtc
tccacgctggcgagggagctaggctcaaaagagtggcagttccaagactatgacgactac
tacgagtggtggattaggttcaaggacgcgcttgacaagctcatcagtgggggtgcctag

DBGET integrated database retrieval system