KEGG   Pyrobaculum islandicum: Pisl_1230Help
Entry
Pisl_1230         CDS       T00444                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pisl_1230
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_1230
   00020 Citrate cycle (TCA cycle)
    Pisl_1230
   00620 Pyruvate metabolism
    Pisl_1230
   00640 Propanoate metabolism
    Pisl_1230
   00650 Butanoate metabolism
    Pisl_1230
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pisl_1230
   00680 Methane metabolism
    Pisl_1230
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pisl_1230
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pisl_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1114395..1114916
Genome map
AA seq 173 aa AA seqDB search
MLEFRFHGRGGQGMVTAAQVLATAAILEGKYAQAFPEFGPERRGAPVKSYLRISDNPIYL
REPVLNPDVIVVADHSLFVAENPLDGAKPTTILVVNGVYKTSLKTYYIDATSLSMKILGR
PIVNTALIGAVIKATSVVSLSSVIEALRKYFSGKLYDLNVKLIETAYQETKEL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgttagagtttcgttttcacggccgcggcggccagggtatggttaccgcagcacaagtt
cttgcgacagcggcaatactagagggtaaatacgcacaagcatttcctgagtttggccca
gaacgtagaggggctcctgtaaaatcctacctccgtatctccgacaatccgatatacttg
cgtgagcctgtcttaaacccagatgttattgtagtggcggaccactcactctttgttgcc
gaaaatcctcttgatggggcgaagcccacgactattctagttgtaaacggcgtatataag
acatctttaaagacttattacatagatgcaacttccctctctatgaaaatcttagggagg
cctattgtaaacacggctttgataggcgcggttattaaggcaacaagtgtggtttcgtta
agctcggtaattgaagcattgagaaaatacttctcaggcaagctatacgatctaaatgta
aaactaatagagacggcataccaggagacaaaagagctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system