KEGG   Pyrobaculum islandicum: Pisl_1316Help
Entry
Pisl_1316         CDS       T00444                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pis  Pyrobaculum islandicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pisl_1316
Enzymes [BR:pis01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pisl_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1191804..1193243
Genome map
AA seq 479 aa AA seqDB search
MLRGFGVLLHISSLPGGCLAGDLGPSAYKFAEFLSKAEATYWQILPLSHTLPEYDDSPYS
AVSLLAGNPALISLEKMAQDGLLVRSPPKCPSVERTSFAESWELKRRYVEEAFETKLGWR
DYEEFIAENSWWLESYGRYMALRETFRVPWIQWPEWARRLNTPLPPKLAKLAEFYKYVQY
VFWRQWDDLKRYVNSLGIFIIGDLPIYPALDSADVWEGRRYFKLAPDGTPLYVSGVPPDY
YSPTGQLWGTPVYNWEELRRDRYVWWTRRLTRMLSLFDYLRLDHFRGYVSYWEVPYGEPT
AVRGRWAPGPGEELFKAVEETLPRLIAEDLGFITPDVVELRRRLGIPGMRVLQFAWDGNP
ANEHKPHNYERNLVAYTGTHDNNTIVGWWREETTPRSRREALAYIGGCGREINWCFIRLL
FSTVADVAVVPIQDVLGLGSEARINKPGTLRGNWKWKLAKDPPINFAVRLRRLAKLYGR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
gtgctcagaggctttggagtactcctacatatatctagtctccccggcgggtgtctagcc
ggtgatctggggccatccgcttataaatttgccgagtttctctctaaagctgaggctacc
tactggcaaatcctccccctaagtcatacacttccagagtatgacgactctccttatagc
gcagtctcgctattagccggaaaccccgctcttataagtcttgaaaaaatggcgcaagac
ggattgttggttagatctccccccaaatgtccgtctgtagagaggacaagttttgcagag
tcatgggagctaaaaaggcggtatgttgaagaggcatttgagaccaaactcggctggcga
gactacgaggaatttatagccgagaactcctggtggctagagtcctatggcagatatatg
gcacttagggagacttttagagtgccatggatccaatggccagagtgggctcgaagacta
aacacgccgctaccgcctaaattggccaagttggcagagttctataaatatgtccaatat
gtcttctggcgtcaatgggatgatctaaagagatatgtcaacagtctggggatattcatc
ataggcgatctcccgatttatccagcgttagacagtgccgacgtttgggaaggccggaga
tacttcaagcttgcgccagacggaacccccctctatgtctccggggtgccgcctgactac
tactcgccaactggccagctctggggaaccccagtatacaactgggaggagctgaggaga
gaccgctacgtctggtggacgcggcggcttacgcggatgttgtctttattcgattaccta
cgtctcgaccacttcagaggttacgtgtcatattgggaggtgccgtatggcgagcccacg
gcggttagaggtagatgggcgccaggtcccggagaggagctctttaaggctgtcgaagag
actctcccaaggcttatagcggaggatctgggctttataactccagacgtggtggagctt
aggaggaggctgggcattcccggcatgcgcgtcctacagtttgcctgggatggaaatccc
gcgaatgaacataagccgcataactacgagagaaaccttgtggcgtataccggaactcac
gacaacaacactatagtcggttggtggagagaggagacaacaccgaggtcaaggcgggag
gccctcgcatacataggcggctgcgggagagagataaactggtgtttcatacgccttctt
ttttctacggtggcagacgtggcggtcgtcccaatacaagacgtccttgggctgggtagc
gaggccaggataaacaagcccggcacccttagaggcaactggaaatggaaactggctaaa
gacccgcctataaatttcgccgtaagactaaggcgactcgctaagctctacggccgttag

DBGET integrated database retrieval system