KEGG   Pyrobaculum islandicum: Pisl_1343Help
Entry
Pisl_1343         CDS       T00444                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00620  Pyruvate metabolism
pis00630  Glyoxylate and dicarboxylate metabolism
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01120  Microbial metabolism in diverse environments
pis01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pisl_1343
   00630 Glyoxylate and dicarboxylate metabolism
    Pisl_1343
Enzymes [BR:pis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pisl_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ABL88506
JGI: Pisl1343
UniProt: A1RU74
Position
complement(1219845..1222289)
Genome map
AA seq 814 aa AA seqDB search
MVIEINREVLKKFPELFGEKIVNGRKVVVEDLIEKLTREFRSDIDRVVRARREWLNDRRP
VREKATFPRWDEKFVDADGNVRTFREIVQGLIDNFLGRDTPLRWGLNWNTPVPDDLHPLK
NPGLEITGPWYPMSRAIHQINADVASMMEDEEDASPAWFIPWGSGRSVAAVWEARRIVKR
VLEGDIPTPYIEGGKAYYVKKERSKWPTLIHRIPGLHILDFDIRVDGRPVPAVITSIVIY
TVNNYDQLKKVGSGVYFYVPKVQTPDEALVIEKILRRVEDELGLKRGEIKIAMLYEEARA
GLYLPVIFWIWRERLVKSNNGRWDYLGSLIEMWKDEAVYPDPQNITMTHPIMMAYQKYNA
LLCLMAGLDREGKLNAAPVGGMAAVMLYRPDDPYQRNRYNARALRAIWLDKLRERLIGLI
FVTEEAVSKVTLKDILEGKVKGRLYDLFRQSWVATPEESYVKAGNEPLKASLEELQAMIN
RPVKYVEVDSVKIPAVDSGLTEQERQLFQRLGLIDENGNITPWVIRPEMLDSPEKLFNNV
ELWGGKDLWSALYEPPKGDITIEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFMND
LATYRIFSTWLWTLLRHKARITKDGALKGPAKTRLGVIPADDRIKISAGTQFDEELFEKL
WELHMEWTYAFYEDLDRISAERILLRFVENVKNILHNAYKAGPFRFQTPIDTARKIAELF
KVEELEKAVIENQPRFDRSFASVIMDILKVKLTSPMYLQHGGRLIMVLAPLPDEERSTVL
RALFTPREEVEKLVKEGKLKSYVLELYDYIHDIR
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggtaatagaaattaatagagaagtattaaagaaatttcccgagttgtttggtgaaaag
attgtaaatggaagaaaagttgtagtcgaagatttaatagagaaacttacgagagaattc
cgttctgatatcgatagagtcgtgagagcgagaagggagtggcttaatgatagaagacct
gtccgtgagaaagcaacgtttcctcgttgggatgagaaatttgtagacgccgatggaaac
gtaagaacatttagagaaattgtacaaggccttattgacaatttcctaggtagagacaca
ccgctgaggtggggtctcaactggaacacgcctgtgccagacgatttacatccacttaaa
aaccccgggcttgagataacagggccttggtaccccatgagtagagctatccaccaaatt
aacgccgatgtcgcatctatgatggaagacgaggaagacgcaagtcccgcgtggttcatt
ccctggggctctggcagatctgtcgcggctgtgtgggaagctaggagaattgtaaaaagg
gtattagagggagatataccgacgccgtatatagaggggggcaaggcgtattacgttaaa
aaggagagatctaagtggcctactctaattcacagaatacctgggctccatattttagac
tttgacatcagagttgacgggaggccggtccccgctgttattacatctattgtgatatac
accgtgaataactatgaccagcttaaaaaagtaggctctggcgtctatttctatgtccca
aaggttcaaacaccagacgaggcgttagtcatagagaaaattttgagacgtgtagaagat
gaactggggctaaagagaggcgagataaaaattgctatgctgtatgaagaggccagagct
gggctatatctgccggtgatcttctggatatggagagagagacttgttaaaagcaacaac
ggccggtgggactacttgggctctcttattgagatgtggaaagacgaagcagtgtaccca
gatcctcagaatataacaatgacccaccccattatgatggcctatcagaagtacaacgcg
cttctctgcctaatggctggtcttgacagagagggaaagctcaacgcggcgcctgtcgga
gggatggccgcggtcatgctatataggccggatgacccataccagcgaaataggtataac
gcaagggcgttaagggccatatggctagataagctaagggagagactaatcggcttgatt
tttgttacagaagaggccgttagcaaagtgactctcaaagacatacttgaaggaaaggtg
aagggtaggctttatgacttattccgacagagctgggtggcgacgcctgaagagtcctat
gtaaaagctggtaacgagccgcttaaggcaagcctggaggagctacaggcaatgataaac
aggcctgtgaaatatgtagaagtcgatagcgttaagatcccagctgtagacagcggattg
acagaacaggagagacaactcttccagagacttgggcttatagacgaaaatggtaatatc
actccatgggtaatacggcctgagatgttggacagtccagagaaactatttaacaacgtg
gaactatggggaggaaaagacctttggtcagctctctatgagcctcctaagggcgatatt
acaattgaacatatacagcacgccttctatatggcagctaactacggcttccaacttcta
aatggcaacttagcagctgcaatagacgactacgaactgggccagagatttatgaacgac
ttagctacatatcgtatattctccacctggctttggacgctccttagacataaagcacgt
ataacaaaagatggcgcattaaaagggcctgctaagacgcgactcggcgttataccggct
gatgacagaattaagataagtgctggaacccagttcgacgaagaactctttgaaaagctc
tgggagttacatatggaatggacttacgccttttacgaagacttagatagaatatctgcc
gagagaatactactacgctttgtagaaaacgtaaagaatatacttcacaacgcctataag
gcagggccatttagattccaaacacccatagacacagccagaaaaatcgccgagttgttt
aaggtagaagagcttgagaaagcagttatagaaaaccagcctagattcgacagatccttc
gcctcagtcattatggatatcctaaaggtgaagctaacatctccgatgtatttgcaacac
ggcggccgtcttattatggtgttagctcccctacctgatgaggagaggagcactgtacta
cgcgctctcttcactccaagagaggaggtagagaaattagttaaagagggcaaactaaag
tcctacgtgcttgaactatacgattatatacacgatattcgataa

DBGET integrated database retrieval system