KEGG   Pyrobaculum islandicum: Pisl_1343Help
Entry
Pisl_1343         CDS       T00444                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pis  Pyrobaculum islandicum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pisl_1343
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Pisl_1343
   00630 Glyoxylate and dicarboxylate metabolism
    Pisl_1343
Enzymes [BR:pis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Pisl_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1219845..1222289)
Genome map
AA seq 814 aa AA seqDB search
MVIEINREVLKKFPELFGEKIVNGRKVVVEDLIEKLTREFRSDIDRVVRARREWLNDRRP
VREKATFPRWDEKFVDADGNVRTFREIVQGLIDNFLGRDTPLRWGLNWNTPVPDDLHPLK
NPGLEITGPWYPMSRAIHQINADVASMMEDEEDASPAWFIPWGSGRSVAAVWEARRIVKR
VLEGDIPTPYIEGGKAYYVKKERSKWPTLIHRIPGLHILDFDIRVDGRPVPAVITSIVIY
TVNNYDQLKKVGSGVYFYVPKVQTPDEALVIEKILRRVEDELGLKRGEIKIAMLYEEARA
GLYLPVIFWIWRERLVKSNNGRWDYLGSLIEMWKDEAVYPDPQNITMTHPIMMAYQKYNA
LLCLMAGLDREGKLNAAPVGGMAAVMLYRPDDPYQRNRYNARALRAIWLDKLRERLIGLI
FVTEEAVSKVTLKDILEGKVKGRLYDLFRQSWVATPEESYVKAGNEPLKASLEELQAMIN
RPVKYVEVDSVKIPAVDSGLTEQERQLFQRLGLIDENGNITPWVIRPEMLDSPEKLFNNV
ELWGGKDLWSALYEPPKGDITIEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFMND
LATYRIFSTWLWTLLRHKARITKDGALKGPAKTRLGVIPADDRIKISAGTQFDEELFEKL
WELHMEWTYAFYEDLDRISAERILLRFVENVKNILHNAYKAGPFRFQTPIDTARKIAELF
KVEELEKAVIENQPRFDRSFASVIMDILKVKLTSPMYLQHGGRLIMVLAPLPDEERSTVL
RALFTPREEVEKLVKEGKLKSYVLELYDYIHDIR
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggtaatagaaattaatagagaagtattaaagaaatttcccgagttgtttggtgaaaag
attgtaaatggaagaaaagttgtagtcgaagatttaatagagaaacttacgagagaattc
cgttctgatatcgatagagtcgtgagagcgagaagggagtggcttaatgatagaagacct
gtccgtgagaaagcaacgtttcctcgttgggatgagaaatttgtagacgccgatggaaac
gtaagaacatttagagaaattgtacaaggccttattgacaatttcctaggtagagacaca
ccgctgaggtggggtctcaactggaacacgcctgtgccagacgatttacatccacttaaa
aaccccgggcttgagataacagggccttggtaccccatgagtagagctatccaccaaatt
aacgccgatgtcgcatctatgatggaagacgaggaagacgcaagtcccgcgtggttcatt
ccctggggctctggcagatctgtcgcggctgtgtgggaagctaggagaattgtaaaaagg
gtattagagggagatataccgacgccgtatatagaggggggcaaggcgtattacgttaaa
aaggagagatctaagtggcctactctaattcacagaatacctgggctccatattttagac
tttgacatcagagttgacgggaggccggtccccgctgttattacatctattgtgatatac
accgtgaataactatgaccagcttaaaaaagtaggctctggcgtctatttctatgtccca
aaggttcaaacaccagacgaggcgttagtcatagagaaaattttgagacgtgtagaagat
gaactggggctaaagagaggcgagataaaaattgctatgctgtatgaagaggccagagct
gggctatatctgccggtgatcttctggatatggagagagagacttgttaaaagcaacaac
ggccggtgggactacttgggctctcttattgagatgtggaaagacgaagcagtgtaccca
gatcctcagaatataacaatgacccaccccattatgatggcctatcagaagtacaacgcg
cttctctgcctaatggctggtcttgacagagagggaaagctcaacgcggcgcctgtcgga
gggatggccgcggtcatgctatataggccggatgacccataccagcgaaataggtataac
gcaagggcgttaagggccatatggctagataagctaagggagagactaatcggcttgatt
tttgttacagaagaggccgttagcaaagtgactctcaaagacatacttgaaggaaaggtg
aagggtaggctttatgacttattccgacagagctgggtggcgacgcctgaagagtcctat
gtaaaagctggtaacgagccgcttaaggcaagcctggaggagctacaggcaatgataaac
aggcctgtgaaatatgtagaagtcgatagcgttaagatcccagctgtagacagcggattg
acagaacaggagagacaactcttccagagacttgggcttatagacgaaaatggtaatatc
actccatgggtaatacggcctgagatgttggacagtccagagaaactatttaacaacgtg
gaactatggggaggaaaagacctttggtcagctctctatgagcctcctaagggcgatatt
acaattgaacatatacagcacgccttctatatggcagctaactacggcttccaacttcta
aatggcaacttagcagctgcaatagacgactacgaactgggccagagatttatgaacgac
ttagctacatatcgtatattctccacctggctttggacgctccttagacataaagcacgt
ataacaaaagatggcgcattaaaagggcctgctaagacgcgactcggcgttataccggct
gatgacagaattaagataagtgctggaacccagttcgacgaagaactctttgaaaagctc
tgggagttacatatggaatggacttacgccttttacgaagacttagatagaatatctgcc
gagagaatactactacgctttgtagaaaacgtaaagaatatacttcacaacgcctataag
gcagggccatttagattccaaacacccatagacacagccagaaaaatcgccgagttgttt
aaggtagaagagcttgagaaagcagttatagaaaaccagcctagattcgacagatccttc
gcctcagtcattatggatatcctaaaggtgaagctaacatctccgatgtatttgcaacac
ggcggccgtcttattatggtgttagctcccctacctgatgaggagaggagcactgtacta
cgcgctctcttcactccaagagaggaggtagagaaattagttaaagagggcaaactaaag
tcctacgtgcttgaactatacgattatatacacgatattcgataa

DBGET integrated database retrieval system