KEGG   Pyrobaculum islandicum: Pisl_1432Help
Entry
Pisl_1432         CDS       T00444                                 

Definition
(GenBank) Cellulase
Organism
pis  Pyrobaculum islandicum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1298927..1300015)
Genome map
AA seq 362 aa AA seqDB search
MEEFISLLKKLSEARGPSGFEDEVRELVIKEMEPYVDEVTVDRWGNVIGVKRGSSSYRAM
VAAHMDEIGLVVDHIDKEGFLRFRPIGGWNEVTLLGQRVWVKTLDGRWVRGVIGVMPPHV
TPSGKEREAPEMKDLYIDVGARNREEVEKMGLSVGSVAVLDREFAILNERVVTGKAFDDR
VGLAVMLYTLRQLGDLPATLYAVATVQEEVGLRGAQIAAERINPHYAIALDTTIAADVPG
VGERLHVTKVGAGPAIKVIDGGRGGLFIAHPGLRDHIVRIAREAGIPHQLEVLYGGTTDA
MAIAFRREGVPAAAISIPTRYVHSPVELVDLSDALNASKLLKNVLEKTPPDIIDKFLDRR
VK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggaagagtttatatcgttgttgaaaaaactttcggaggcgagaggcccttcgggtttt
gaagatgaagttcgagagctcgtgattaaagaaatggagccgtatgtagatgaagtaaca
gtagatagatgggggaatgtaataggtgtcaaaaggggttcttctagctaccgcgctatg
gtggcggcacatatggacgagattgggcttgtcgttgaccacatagataaggagggcttc
ctaaggtttaggcctatcggcggttggaacgaggtaactctcctcggccagcgggtttgg
gttaaaactctagacggtaggtgggttaggggggttatcggcgttatgccgccgcacgtc
actccgtctggtaaagagagggaggcccccgagatgaaagatctctacatagacgtgggg
gctagaaacagagaggaggtcgaaaagatgggactttctgtagggtctgtagcagtttta
gacagagagttcgccattcttaacgaaagggttgtcactggaaaggcttttgacgataga
gtaggcttggctgttatgctctatactctgagacaactcggcgatctccccgcgactcta
tacgccgtggcgacagtacaagaagaggtagggcttcgcggtgcgcaaatcgccgccgag
agaattaaccctcattacgccatcgccttagacaccaccatagcggccgacgtgcctggc
gtaggcgagagactacatgtgacaaaggtgggggcggggcccgctataaaggtcatcgac
ggcggacgcgggggtctcttcatagctcacccaggtctcagagaccacattgtgagaatc
gccagagaggccggcatcccgcaccagctagaggttctatatggcggcactacagacgcc
atggctatagcctttaggcgcgagggcgtgcccgccgccgctatctctatcccaactcgc
tatgtccactcgcctgtagagctagtagatctgtcagacgcgttgaacgcctctaaactg
ttaaaaaacgttctagagaaaacgccgcctgacataatagacaaattcctagataggaga
gtaaagtga

DBGET integrated database retrieval system