KEGG   Pyrobaculum islandicum: Pisl_1503Help
Entry
Pisl_1503         CDS       T00444                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pis  Pyrobaculum islandicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pisl_1503
   00052 Galactose metabolism
    Pisl_1503
   00500 Starch and sucrose metabolism
    Pisl_1503
   00520 Amino sugar and nucleotide sugar metabolism
    Pisl_1503
Enzymes [BR:pis01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pisl_1503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1371538..1372356
Genome map
AA seq 272 aa AA seqDB search
MQAVVAAAGLGTRLLPASKEVPKEMFPVFVWEGGSLLVKPVLQVVFEQLFDAGVREFCFV
VGRGKRAVEDYFTPDWGLVEYLERAGKAEAAGALARFYERVEASAIFYVNQPKPLGFGHA
VLTAEPFIHGDFVVAAGDTFLMDGAPLAALVSSPPMAIMVKEVEDPRQYGVAVVEGGRVV
RVVEKPRDPPSRLAILPFYKLPSDFFRYLRRVRPGVGGEIQLTDAIQLAIEEGVEARPVF
YGGEYVDVGTPQTYLKALELALHVARKNSRVD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctgttgtggcggcggctggtcttggtacgcgtcttctgccggctagtaaggag
gtgcctaaggagatgtttcctgtttttgtgtgggaggggggttctctgttggttaagcct
gtgttgcaggtggtttttgagcagctttttgacgccggcgtgagggagttttgttttgtg
gtgggtaggggtaagagggctgtggaggactacttcacgcccgactgggggctggtggag
tatctggagagggctggcaaggccgaggcggcgggggcgctggcccgcttctacgagagg
gttgaggcctccgctattttctacgtcaaccagcccaagcctcttgggtttggccacgcc
gtccttacggctgagccgtttatacacggcgatttcgtggtggcggctggcgacacgttc
ctcatggacggggcgcctctcgccgccctagtctcctctccccccatggccattatggtt
aaggaggtggaggacccgaggcagtatggggtggccgtggtggagggggggagggtcgtg
agagtggtggagaagcctagggatccgccctcccgcctggctatactccccttctacaag
ctccccagcgacttctttagatatcttaggagggttaggccgggggtcggtggagagatc
cagctgacggacgcaatacaattggctattgaggagggggtcgaggctaggccggtcttc
tacgggggtgagtacgtcgacgtgggcactccgcaaacctatttaaaagccctcgagctg
gctctacatgtggcgagaaaaaactctagagttgattaa

DBGET integrated database retrieval system