KEGG   Pyrobaculum islandicum: Pisl_1585Help
Entry
Pisl_1585         CDS       T00444                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pisl_1585
   01230 Biosynthesis of amino acids
    Pisl_1585
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_1585
   00051 Fructose and mannose metabolism
    Pisl_1585
   00562 Inositol phosphate metabolism
    Pisl_1585
Enzymes [BR:pis01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pisl_1585
Exosome [BR:pis04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pisl_1585
  Exosomal proteins of bladder cancer cells
   Pisl_1585
  Exosomal proteins of melanoma cells
   Pisl_1585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1444370..1445059
Genome map
AA seq 229 aa AA seqDB search
MKFPILIINLKAYGEAAGKKALEIAKAAEKVAKELGVNIAVAPNHLELALVAQSVEIPVY
AQGADVETPGAYTAHIAVDNIKAVGASGLILNHSEAPLALNQLSKLAARAKSIGLDVVIC
APDPVTSLAAAALGPHAVAVEPPELIGTGKAVSKYKPETIIETVRLVTKHFPNVVVITGA
GIETGEDVEAALKLGTKGVLLASAAVKAKDHYQKIFELAKPLTVAAEPP
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtttccaatactaattataaatctaaaagcctatggcgaggctgcaggcaaaaag
gcactggaaatagccaaggcggcggaaaaagttgctaaagagctcggcgtaaatatagct
gtggcgcctaaccatttagagctcgccctagttgcgcagtctgttgaaataccagtgtat
gcgcaaggcgcagatgtagaaacgccaggcgcttatacagcgcatatagctgtagataat
ataaaagctgtcggagcgtcggggctgattttaaatcatagtgaagcgcctcttgccttg
aaccaactctctaagttggctgcaagagctaagtctataggtctagacgtagtgatatgc
gcccccgaccctgtgacaagtcttgcggcggctgcgctagggccccacgccgtagctgta
gagccgcctgagctaataggcaccggcaaagctgtctcaaagtataaacctgagacaata
atcgaaactgtaaggctagtgacaaaacactttccaaacgtcgtagttataaccggcgcc
ggtattgaaacaggtgaagatgtagaggcagcacttaagctaggcaccaagggggtgctt
cttgcaagcgctgcagttaaggctaaagaccactaccagaaaattttcgagttggcaaag
ccgcttacagtcgcggcggagccgccttag

DBGET integrated database retrieval system