KEGG   Pyrobaculum islandicum: Pisl_1601Help
Entry
Pisl_1601         CDS       T00444                                 

Definition
(GenBank) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00010  Glycolysis / Gluconeogenesis
pis00071  Fatty acid degradation
pis00350  Tyrosine metabolism
pis00625  Chloroalkane and chloroalkene degradation
pis00626  Naphthalene degradation
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01120  Microbial metabolism in diverse environments
pis01130  Biosynthesis of antibiotics
pis01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_1601
  Lipid metabolism
   00071 Fatty acid degradation
    Pisl_1601
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pisl_1601
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pisl_1601
   00626 Naphthalene degradation
    Pisl_1601
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pisl_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DUF4521 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABL88755
JGI: Pisl1601
UniProt: A1RUX3
Position
1455751..1456905
Genome map
AA seq 384 aa AA seqDB search
MLKEFKLRYEGVLLHFGTGTIEKSKNYLHQFEKVVIVTGRSSAKTSGALDDVERVLKELG
VKYVLFNKVSPNPWASQAEELAKVVWEEGADAVIAIGGGSPIDVSKIATIIVANGGKVYD
YVRGVKKAKRMIPLIAVNLTHGTGTEVDKWAVVTLDDTREKIGIAARYPDLSIDDPTYTL
TLDERQTIYTSLDAFYHSYESATAKTSNPLSQSLAESAIGTIAETLPKLAENLRDLALRY
RMLYASMIAGIAIDMARTHIIHAIEHVLSGLEPKLPHGCGLGLLGPRAVYYIHKAAPELS
ARLLRHINPHIKPTIDSAAEAEKTVAKFQEEIGLRERLSDYGFTERDVANIAERVFTTFR
EWINTTAPLEVTKDVIIDILKSAL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagagtttaagctcaggtacgaaggtgttttactccattttggcacaggaaca
atagagaagagtaagaactacctacaccagtttgaaaaagttgtaatcgtcactgggagg
tcgtcagctaagacatccggcgccttagatgatgtagagagagtattgaaggagcttggc
gttaagtatgtgttgtttaacaaagtttcgccaaacccctgggcaagtcaagcggaggaa
ttagctaaagtcgtatgggaagagggggctgatgcagtaatagccataggaggcggaagc
ccaatagacgtctctaagattgcaactataattgttgcaaacggcggaaaggtatacgac
tatgtcagaggcgttaaaaaagcaaaaagaatgatacctctgatagcagtaaatctcacc
catggcacaggtacagaggtggataaatgggccgtagttacacttgatgacaccagagag
aaaataggtatagcggcgcggtacccagatttgtctatagacgaccccacatatacttta
acactagacgagagacaaacgatctatacatctctagacgccttttatcactcttatgaa
tccgccacagctaagacttcaaatcctctatcgcagtcgcttgccgaaagtgcaataggc
acaatagctgaaactttgcctaagttggcagaaaacttgagagatttagcgcttcgctat
agaatgctctatgcatctatgattgcaggaattgccatagatatggcgcgtacacatata
atacacgccatagaacatgtattaagcggcctagagcccaagctaccacatggctgtgga
ttagggttactgggcccgcgcgcagtttattacatacataaggcggcgcctgaactctca
gcccgtcttctcagacatataaacccccatataaagcctactatagatagcgccgctgag
gcagaaaaaacagttgcaaaattccaggaggagataggccttagagagagactaagcgac
tacggcttcaccgagagagatgtagcaaatatagccgagagagtctttacaacttttaga
gagtggataaataccacagctcctttagaggtgacaaaagacgtaataatcgacatatta
aaaagcgcgctctag

DBGET integrated database retrieval system