KEGG   Pyrobaculum islandicum: Pisl_1601Help
Entry
Pisl_1601         CDS       T00444                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pisl_1601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_1601
  Lipid metabolism
   00071 Fatty acid degradation
    Pisl_1601
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pisl_1601
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pisl_1601
   00626 Naphthalene degradation
    Pisl_1601
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pisl_1601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1455751..1456905
Genome map
AA seq 384 aa AA seqDB search
MLKEFKLRYEGVLLHFGTGTIEKSKNYLHQFEKVVIVTGRSSAKTSGALDDVERVLKELG
VKYVLFNKVSPNPWASQAEELAKVVWEEGADAVIAIGGGSPIDVSKIATIIVANGGKVYD
YVRGVKKAKRMIPLIAVNLTHGTGTEVDKWAVVTLDDTREKIGIAARYPDLSIDDPTYTL
TLDERQTIYTSLDAFYHSYESATAKTSNPLSQSLAESAIGTIAETLPKLAENLRDLALRY
RMLYASMIAGIAIDMARTHIIHAIEHVLSGLEPKLPHGCGLGLLGPRAVYYIHKAAPELS
ARLLRHINPHIKPTIDSAAEAEKTVAKFQEEIGLRERLSDYGFTERDVANIAERVFTTFR
EWINTTAPLEVTKDVIIDILKSAL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagagtttaagctcaggtacgaaggtgttttactccattttggcacaggaaca
atagagaagagtaagaactacctacaccagtttgaaaaagttgtaatcgtcactgggagg
tcgtcagctaagacatccggcgccttagatgatgtagagagagtattgaaggagcttggc
gttaagtatgtgttgtttaacaaagtttcgccaaacccctgggcaagtcaagcggaggaa
ttagctaaagtcgtatgggaagagggggctgatgcagtaatagccataggaggcggaagc
ccaatagacgtctctaagattgcaactataattgttgcaaacggcggaaaggtatacgac
tatgtcagaggcgttaaaaaagcaaaaagaatgatacctctgatagcagtaaatctcacc
catggcacaggtacagaggtggataaatgggccgtagttacacttgatgacaccagagag
aaaataggtatagcggcgcggtacccagatttgtctatagacgaccccacatatacttta
acactagacgagagacaaacgatctatacatctctagacgccttttatcactcttatgaa
tccgccacagctaagacttcaaatcctctatcgcagtcgcttgccgaaagtgcaataggc
acaatagctgaaactttgcctaagttggcagaaaacttgagagatttagcgcttcgctat
agaatgctctatgcatctatgattgcaggaattgccatagatatggcgcgtacacatata
atacacgccatagaacatgtattaagcggcctagagcccaagctaccacatggctgtgga
ttagggttactgggcccgcgcgcagtttattacatacataaggcggcgcctgaactctca
gcccgtcttctcagacatataaacccccatataaagcctactatagatagcgccgctgag
gcagaaaaaacagttgcaaaattccaggaggagataggccttagagagagactaagcgac
tacggcttcaccgagagagatgtagcaaatatagccgagagagtctttacaacttttaga
gagtggataaataccacagctcctttagaggtgacaaaagacgtaataatcgacatatta
aaaagcgcgctctag

DBGET integrated database retrieval system