KEGG   Pyrobaculum islandicum: Pisl_1636Help
Entry
Pisl_1636         CDS       T00444                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pis  Pyrobaculum islandicum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pisl_1636 (folE)
Enzymes [BR:pis01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Pisl_1636 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1484569..1485129
Genome map
AA seq 186 aa AA seqDB search
MTLEKKMLKPEEGVKILLEHLGEDVTRPGVVETPKRFVKALWELTRGLREPPPEVVFFPM
EYDAEPGPVVIENISAVSLCEHHLLPIFLSVSVAYVPGDGVPGLSKVIRLVKWAAARPIM
QERFTQWLADLLMEKLKARAVAVRVCGVHMCSFIRGVRDEHHNMVTVAKRGDIDVKLRCR
RPPLCK
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
gtgactttggaaaaaaagatgttaaagccggaggagggcgttaagatacttctagaacat
ctaggggaggatgtcacaaggccgggcgttgtcgagacgcctaagaggtttgtaaaagcg
ttatgggaactgactagaggcttaagggagccgcctcctgaggtcgtgttttttccaatg
gaatacgatgcagagccggggcctgttgtgattgaaaacataagcgcagtctctctctgc
gaacatcatctgcttcccatattcctcagcgtctcagtcgcctatgttcccggagatggc
gtgccagggcttagcaaggtgattaggttagtcaagtgggctgccgcgagacctataatg
caagagaggttcacccagtggcttgccgatctgttaatggaaaaactcaaagcaagagcg
gtcgcggtgagggtatgtggcgtgcatatgtgttcgtttatcagaggagttcgcgacgaa
catcacaacatggttactgtagcaaagaggggggatatcgatgtgaaactaagatgtaga
aggccgccgctgtgtaaatga

DBGET integrated database retrieval system