KEGG   Pyrobaculum islandicum: Pisl_1710Help
Entry
Pisl_1710         CDS       T00444                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00010  Glycolysis / Gluconeogenesis
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01120  Microbial metabolism in diverse environments
pis01130  Biosynthesis of antibiotics
pis01200  Carbon metabolism
pis01230  Biosynthesis of amino acids
Module
pis_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_1710
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Pisl_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA Sacchrp_dh_NADP 3HCDH_N NAD_binding_2 F420_oxidored IlvN
Motif
Other DBs
NCBI-ProteinID: ABL88861
JGI: Pisl1710
UniProt: A1RV79
Position
complement(1546221..1547255)
Genome map
AA seq 344 aa AA seqDB search
MIKVGIIGYGTIGKRIADAVAMQDDMKVVGVLKVTPDYEAKIALARGFPIYTYSDRFDKF
KKAGIEPAGTIEDLIKASDIIIDASPEDVGRENKEKYYQRYDKPVIFQGGEEADVADVSF
NALANYEEAKGRRYVRVVSCNTTGITRVLTSLILNGIGIKKARIFIARRGADPKEHKKGP
INDVVPNPATVPSHHGPDVQTILKDIDIVTMAIAVPVTIMHMHMAYIELSSTYTKDAVIE
AFVKTPRIFLADVGSGFQSLAHVIEYARDLGRSRSDFPEVAIFRDSVTIRGNELYLMYGV
HQESIVVPENVDAIRAVLGILPKWRSIEKTDKTLKLITEGKVYG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagtaggaattataggctacggcacaataggtaagagaatagcagatgcggta
gcaatgcaagacgatatgaaagtagtcggcgtgttaaaagtcacgccagactacgaggct
aagatagcgttggcacgcggctttccaatatatacatactctgacagatttgataaattt
aaaaaagctggcatagagccagcaggtacgatcgaagatttaatcaaagcgtctgatata
ataattgatgcctcgccggaggacgtagggcgtgagaacaaagagaagtattatcaaagg
tatgacaaacctgtaattttccagggaggcgaagaagcagatgtagctgacgtaagcttt
aacgccttggctaattacgaagaagcgaaagggagacgctatgtgagagtggtaagttgt
aacacgacaggaatcactagagttctcacatctttgatcttgaatgggataggcattaaa
aaggcgaggatatttatcgccaggagaggcgcagatcctaaggagcataagaaggggcct
attaatgacgttgtgcccaacccggctactgtgcccagccaccacgggcctgatgtacag
acaatactcaaagatatcgacattgtaacgatggcaatagctgtgcctgttacaataatg
catatgcacatggcatacatagaactaagctctacatatacaaaagatgccgtgatagag
gcttttgtaaaaactccacgtatctttttggcagatgtagggtctggatttcaaagcttg
gcgcatgttatagaatatgccagagatttgggaaggtcgagaagcgacttcccagaggtt
gccatctttagagattcggttactatacgtggaaacgagctttacctaatgtacggcgta
catcaagaatctatcgtagtccctgaaaacgttgatgctataagagcagtcttaggcata
ttgcctaagtggcgctcaattgagaaaacagataaaactcttaagttaattacagagggt
aaggtatatggttga

DBGET integrated database retrieval system