KEGG   Pyrobaculum islandicum: Pisl_1912Help
Entry
Pisl_1912         CDS       T00444                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pisl_1912
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pisl_1912
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pisl_1912
Enzymes [BR:pis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pisl_1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1727574..1728281)
Genome map
AA seq 235 aa AA seqDB search
MRRPGLGVYVLAGWPNAEVFKRALTAVGEVADFVELGLPSRNPKYDGPYIRQAHREAEPS
AVEAAPGETYIMAYWEDFAGEPQRLFETARAAGARGVLAPDLLIDFPGDLDRYVELTRRY
GLEPAFFIPSKFPYALLRRLASLKPAFIYLGLYAATGIELPVYVERNIKTVREVAPEVYL
VAGFAIDSPRKAAAVVKAGADAVVVGTAFLRRLRNSVEEAIAFLKEIRGALDSQQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggcccggcctcggcgtgtacgtcctggctggctggcccaacgctgaggttttc
aagagggcgcttaccgccgtgggagaggtggccgacttcgtggagctaggtctgccgagt
agaaacccgaagtacgacgggccctacatcaggcaggcgcatagggaggcggagccgtct
gctgtggaagcggcgcccggcgagacgtacatcatggcctattgggaggacttcgccggg
gagccccagagactgtttgagacggcgcgtgcagcgggggcgaggggggtcctcgccccg
gatctcctcattgacttcccaggcgatctagaccgttatgttgagctgaccaggaggtac
gggctggagccggctttcttcatacccagcaagttcccctacgcgttgcttaggcgcctc
gcctctctaaagcccgccttcatatacctcgggctgtacgccgcaactggcatagagctg
ccggtatacgtcgagagaaacataaagacagttagggaggtggcgcctgaagtctatctg
gtggcgggcttcgccatagacagccctaggaaggccgccgctgtggtgaaggcgggggca
gacgccgtggtggtgggaacagccttcttaagaaggcttagaaactcggtagaggaggcc
atcgccttcctcaaggagataaggggggcgttggactcacagcagtag

DBGET integrated database retrieval system