KEGG   Pyrobaculum islandicum: Pisl_1912Help
Entry
Pisl_1912         CDS       T00444                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pis  Pyrobaculum islandicum
Pathway
pis00260  Glycine, serine and threonine metabolism
pis00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pis01100  Metabolic pathways
pis01110  Biosynthesis of secondary metabolites
pis01130  Biosynthesis of antibiotics
pis01230  Biosynthesis of amino acids
Module
pis_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pisl_1912
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pisl_1912
Enzymes [BR:pis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pisl_1912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE PcrB ThiG His_biosynth IGPS IMPDH NMO KNOX2
Motif
Other DBs
NCBI-ProteinID: ABL89059
JGI: Pisl1912
UniProt: A1RVS7
Position
complement(1727574..1728281)
Genome map
AA seq 235 aa AA seqDB search
MRRPGLGVYVLAGWPNAEVFKRALTAVGEVADFVELGLPSRNPKYDGPYIRQAHREAEPS
AVEAAPGETYIMAYWEDFAGEPQRLFETARAAGARGVLAPDLLIDFPGDLDRYVELTRRY
GLEPAFFIPSKFPYALLRRLASLKPAFIYLGLYAATGIELPVYVERNIKTVREVAPEVYL
VAGFAIDSPRKAAAVVKAGADAVVVGTAFLRRLRNSVEEAIAFLKEIRGALDSQQ
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggcccggcctcggcgtgtacgtcctggctggctggcccaacgctgaggttttc
aagagggcgcttaccgccgtgggagaggtggccgacttcgtggagctaggtctgccgagt
agaaacccgaagtacgacgggccctacatcaggcaggcgcatagggaggcggagccgtct
gctgtggaagcggcgcccggcgagacgtacatcatggcctattgggaggacttcgccggg
gagccccagagactgtttgagacggcgcgtgcagcgggggcgaggggggtcctcgccccg
gatctcctcattgacttcccaggcgatctagaccgttatgttgagctgaccaggaggtac
gggctggagccggctttcttcatacccagcaagttcccctacgcgttgcttaggcgcctc
gcctctctaaagcccgccttcatatacctcgggctgtacgccgcaactggcatagagctg
ccggtatacgtcgagagaaacataaagacagttagggaggtggcgcctgaagtctatctg
gtggcgggcttcgccatagacagccctaggaaggccgccgctgtggtgaaggcgggggca
gacgccgtggtggtgggaacagccttcttaagaaggcttagaaactcggtagaggaggcc
atcgccttcctcaaggagataaggggggcgttggactcacagcagtag

DBGET integrated database retrieval system