KEGG   Pyrobaculum islandicum: Pisl_1916Help
Entry
Pisl_1916         CDS       T00444                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pisl_1916
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pisl_1916
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pisl_1916
Enzymes [BR:pis01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pisl_1916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1731120..1732382)
Genome map
AA seq 420 aa AA seqDB search
MVDRWYNIAADLPGVLAPPKDPDEGESRIALLTRILPSALIDQEFTAERWVPIPEEVREV
YRRVGRPTPLLRAEGFERALGTKVHIYYKYEGVLPVGSHKLNTAVAQAYYAKADGAVEVA
TETGAGQWGMAVSLAAALFGLKATVFMTRSSYNSKRQRLVFMRAYGATVYPSPSEVTETG
RRHFRPDHPGSLGIAISEAVEYVLSGERRKYLPGSVMEFVLLHQTVIGLEAMRQLPEEPD
YAVACVGGGSNFGGFTYPMLGAKLRGEGFGKTKFLAVESAAAPKLTRGEYRYDFPDATGI
LPLIKMYTLGHDYVPPPVHAAGLRYHGAAPSLSLLKRLGHVEAVAYGQEEVMEAALLFAR
SEGVLPAPESAHAVRAVIYLAKKLPPGSVVVFNMSGHGLLDVDAYEKALEWEKIYKHPED
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggtagaccgctggtacaacatcgccgctgatctgcccggggtcctcgctcctcctaag
gacccagatgagggggagagtagaatcgctcttctcaccaggatcctgccctctgcgctg
attgaccaggagttcaccgcagagaggtgggtgcccatacctgaggaggtgagagaggtc
tataggcgggtggggaggcctaccccccttctgagggcggaggggtttgagcgggcgctt
gggactaaggtgcacatatactacaagtacgagggggttctgccggtgggtagccacaag
ctcaacaccgcggtggctcaggcctactacgcaaaggcggatggggctgtggaggtggct
actgagacgggggcggggcagtgggggatggctgtgtctctcgccgcggcgctcttcggc
ctcaaggcgacggtcttcatgacccgctcctcctacaacagcaagaggcagagactggtc
ttcatgagggcgtacggcgccaccgtctacccaagccccagcgaggtgaccgagacgggc
aggaggcacttccggcccgaccacccggggtccctcggcatagccatatctgaggccgtg
gagtacgtcctctcgggggagaggagaaaatatctgccgggtagcgttatggagttcgtc
ctcctccaccagacagtcataggccttgaggccatgagacagttgcccgaggagccggac
tacgcggtggcttgcgtcggcggggggtctaacttcggcggtttcacatacccgatgctt
ggggctaagctcaggggggaggggtttggaaaaaccaagtttctcgccgtggagtccgcc
gccgcccctaagctgacgcggggggagtataggtacgatttcccagacgccacggggata
ctgccgttgattaagatgtacaccctaggccacgactacgtccccccgcctgtccacgcg
gcgggcctgcgctaccacggcgccgctcccagcctctctttgcttaagcggctgggccac
gtggaggcagtggcctacggccaagaggaggttatggaggcggcgttgctttttgcaaga
tcagaaggcgttttgccagctcccgaatcggcacatgcggtaagggctgtgatatatttg
gcaaaaaaactcccgccaggctctgtagttgtgtttaacatgtctggtcatggacttctt
gatgttgacgcgtatgaaaaggctcttgagtgggagaaaatatataaacaccccgaagat
taa

DBGET integrated database retrieval system