KEGG   Pyrobaculum islandicum: Pisl_1949Help
Entry
Pisl_1949         CDS       T00444                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pis  Pyrobaculum islandicum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pis00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pisl_1949
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pisl_1949
  Lipid metabolism
   00071 Fatty acid degradation
    Pisl_1949
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pisl_1949
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pisl_1949
   00626 Naphthalene degradation
    Pisl_1949
Enzymes [BR:pis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pisl_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1763251..1764222
Genome map
AA seq 323 aa AA seqDB search
MLAARLYGPRDLRVEEIPAPKPERGWALVRTLAVGICGTDKAFYRGTYRLFKTPLVPGHE
AVGVAEGGELDGRVVVSEINFACGRCEMCRAGLYTHCPYKRTLGIDFDGGMAEYFVAPLE
ALHPAEGLDPAAATQVEPLAAVLNALAQVPPPPGAKVAILGTGNVAYLAAQVLRGFDPVV
VARRGSAKAHLFRGLGLEVVELGELGEYMAENAPLGFDVVFEATGDPSAINTAIEIARPR
GVIHLKSTPGSPAPANLTPAVVKELRIVGTRCGTYREFRHAIKLIREGIVKPLITSVVTG
IHNAREAFERALQPNEVKVVLKP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttagcggctaggctctacggcccgcgcgacttgcgcgtcgaggagattccggcgccc
aagccagagcgggggtgggcgctggtgagaacgctggcggtggggatctgcggcacagac
aaggccttctacagggggacctaccggctgtttaagacgcctcttgtaccgggccacgag
gcggtgggggtggcggaggggggcgagttggacgggagggtggtggtgagcgagatcaac
ttcgcctgtggtaggtgtgagatgtgtagagctggtctctacacgcactgcccctacaag
aggacgcttgggatagacttcgacggggggatggcggagtacttcgtggcgcctctcgag
gccctccaccccgccgaggggctggacccagccgccgccactcaggtagagccgctggcg
gctgtgttgaacgcccttgcccaggtgccgcctccgccgggggcgaaggtggctatcctg
gggacggggaacgtggcctacctcgcggcgcaagtcctccgggggttcgaccccgtagtg
gtggctaggcgggggagcgccaaggcgcacctcttcagggggctggggctggaggtggtg
gagttgggcgagctgggtgagtacatggcggagaacgcgccgctggggttcgacgtcgtg
tttgaggccactggcgacccctctgcgattaatacggctatagagatagcgaggccccgc
ggcgtgatacacctaaagtccacccccggctcccccgcccccgccaacctaacgccggcg
gtggtcaaagagctgaggatagtgggcactagatgcggcacatacagagagttcagacac
gccatcaagctcattagagaaggcatcgtgaagcccctcatcacctccgtagtaacgggg
atacacaacgcgagagaggctttcgagagggccctccaacccaacgaggtaaaggtagta
ctgaagccctag

DBGET integrated database retrieval system