KEGG   Prevotella intermedia: PIN17_A0138Help
Entry
PIN17_A0138       CDS       T02058                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pit  Prevotella intermedia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pit00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:155145..157838
Genome map
AA seq 897 aa AA seqDB search
MNLQFSIEYKTYYGQELVLNIVNGKESGTNSVCQYRMHTRDGFLWTVEINRDIKPGTVVD
YFYSVHVGDHEERRGWSVAPHRVMFNSAQALNYRIFDHWREIPDNAFLYSSAVTDCVVGA
KIENLKLEKFSKFVCLKVRAPQLGVGDRLCLIGADPLMGSWKEKKAVKMTQVAINEWAAC
LDVSQLASNKLEFKFTILNPNKEYSPMWENCNNRTIELPAMEEGDALIYELNEANFTLPP
TRVAGTLVPLFSLRSDSSFGVGDFGDLKKMVDWVSLTQQKVLQILPINDTTTTHTWTDSY
PYSCISIFALHPQYADLNALPALKDKSQRERFEKERRQLNALPQMDYERVNELKGEYLKL
IYEQEGKAAIGSKEFKAFFAENESWLVPYAQYSMLREKYGTADFAQWPDHNQWDESERKM
LSTSSNKAYKDVEFYYYVQFILSSQLKAVHEYATAKRVILKGDIPIGVNRNGCDVWSEPR
YFNLNGQAGAPPDGFSANGQNWGFPTYNWDAMIADGCQWWLRRFQNMANYFDAYRIDHVL
GFFRIWEIPVHAVHGLLGQFAPSLGMTREEVEGYGLRWQEELFTEPFITDWVIDRIFREH
ANEVRDKYIEKTWGNRYKMRPEFDTQRKVEAAFKGMETDKDIWIRDGLYALISDVLFVRD
HKDPNKFHPRISVQMDFIYESLYDCDKHAFNTLYNDYFYRRNNQYWYQEAMKKLPKLVNA
TRMLVCAEDLGMVPDCVAWVMDELRILSLEIQSMPKDPKVKFGHLGANPYRSVSTISTHD
MATLRQWWDEDWNRAQEYYNTMLHQGGPAPHPMPGWLAKDIVERHLTSPSMLCILGIQDW
MSMDERLRLADADAERINIPANPKHYWRYRMHVSIEQLMKNEDFNKNITELIVRSGR
NT seq 2694 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacaatttagcatagaatataagacatattacggacaagaacttgtcctgaat
atcgtaaacggcaaggagtcgggaaccaattcggtgtgccagtacagaatgcacacacgc
gacggctttctttggacagtagaaatcaatagagatataaagccgggaacggtggtagac
tatttttatagtgtgcacgttggcgaccacgaggaacgtcgtggctggagcgttgcaccc
caccgcgtaatgttcaattcggcgcaagcgttgaattacaggatattcgaccactggcgc
gaaattccagacaatgctttcctgtactcgtcagcagttaccgactgtgtagtaggcgca
aaaatagagaacttgaagttagaaaagttcagcaaattcgtatgcttgaaggtgcgcgct
ccgcaactcggtgtaggcgacaggctctgtctgattggtgccgacccactaatgggctcg
tggaaagaaaagaaagcggtgaagatgacgcaagttgccataaacgaatgggcagcctgt
ctcgacgtaagccagttggcaagcaacaagttggagtttaagtttaccattctaaatccc
aacaaggagtactctccgatgtgggaaaactgcaacaaccgcaccatcgagttgcccgca
atggaagaaggcgacgctttgatatacgaactcaacgaagccaacttcaccctgccgcca
acacgtgtagcaggtacgctggtgccattgttctcgttgcgttccgacagcagcttcggt
gtgggcgactttggcgacttaaagaagatggtggactgggtgagcttgacgcaacaaaag
gtcttgcaaatcctgcctatcaacgataccaccactacacacacgtggacagactcttat
ccatatagctgtatctctattttcgcattgcaccctcagtatgcagacctcaatgcgctg
cctgccttgaaagacaaatcgcagagagaacgcttcgagaaagaacgccgacagctgaat
gcgctgccgcaaatggactacgagcgtgtgaacgaactaaagggagaatatctgaaactt
atatacgagcaggaaggaaaggctgctatcggcagcaaggaattcaaggctttctttgct
gagaacgagagttggctggtgccttacgcacaatacagtatgctgcgcgagaagtatggt
actgccgactttgcacaatggcccgaccacaaccaatgggacgaatcggaaagaaagatg
ctttccaccagcagcaacaaggcttacaaggacgtggagttctattattacgtgcagttc
atattgagcagtcagctgaaggctgtgcacgaatatgccacggcaaagcgtgtgattctg
aaaggcgacattcctatcggtgtaaaccgcaacggttgcgacgtgtggtcagagccacgc
tacttcaatctgaacggtcaggcaggtgcgccgcccgatggtttctcggcaaacggacag
aactggggcttccctacttataattgggacgctatgatagccgacggctgccagtggtgg
ctgcgccgtttccagaatatggcgaactatttcgacgcttaccgcatcgaccacgtgttg
ggtttcttccgcatttgggaaatccccgtacacgccgtgcacggcttgttgggtcagttt
gcgccatcgttgggtatgacacgcgaagaagtggagggctacggactgcgttggcaggaa
gaactgttcaccgaaccgttcattaccgattgggtaatagaccgcattttccgtgagcac
gctaacgaagtgcgcgataaatacatagaaaagacgtggggcaaccgctacaagatgcgc
cctgaatttgatacacagcgcaaagtagaggcagctttcaagggaatggaaaccgataag
gacatttggattcgcgatggtttgtatgccttaatcagcgatgtactcttcgttcgcgac
cataaagacccgaacaaattccacccacgcatcagcgtacagatggatttcatctacgaa
agtctgtacgattgcgacaagcacgcattcaatacgctttacaacgattacttctatcgc
cgcaacaaccagtactggtatcaggaggcaatgaagaagttgccgaagttggtgaacgca
acacgtatgcttgtgtgcgccgaagacttgggaatggtgcccgactgtgtggcttgggta
atggacgagctgcgcatattgagcctcgaaatacagtcaatgccaaaagacccgaaggtg
aagttcggacatttaggtgccaatccttaccgcagtgtgagcaccatctctacccacgac
atggcaacactgcgccaatggtgggacgaagactggaacagggcgcaggaatactacaat
acgatgttgcaccaaggcggtccggcaccgcatccgatgccgggttggttggcaaaagac
attgtagagcgacacttaacatcgccaagtatgctttgtatcctcggtattcaagactgg
atgagtatggacgaacgcctccgattggctgatgccgatgccgaacgcataaacattcct
gccaatccgaaacactattggcgataccgaatgcacgtcagcatagaacaactgatgaag
aatgaggacttcaacaagaacataacagaactgattgtcaggtcaggaagataa

DBGET integrated database retrieval system