KEGG   Prevotella intermedia: PIN17_A0601Help
Entry
PIN17_A0601       CDS       T02058                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pit  Prevotella intermedia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pit00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PIN17_A0601
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PIN17_A0601
Enzymes [BR:pit01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PIN17_A0601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:616305..616919
Genome map
AA seq 204 aa AA seqDB search
MKKIILALFYTLLAFPAMAQKNVYNFKVKDANARTVKLKDYKGKVLLIVNTATKCGFTPQ
YEALQKLYDTYKAQGLVILDFPCNQFGEQAPGTLSEIKAFCTGNYGVTFPQFDKIEVNGK
KELPLYTYLKAQQGFKGFDTNTKIGKFLDEKFSKQDPNYAKNPSIKWNFTKFLIDREGHV
VDRFEPTADMKDVEAGIRAALKVQ
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaataatattagcccttttctacacgcttttggcgtttccagccatggcgcaa
aagaatgtgtacaactttaaagtgaaggacgccaacgcgcgtacagtaaagctgaaagac
tacaaaggcaaggtgttgctcattgtaaacacagccacaaagtgcggtttcacgccgcaa
tacgaagccttgcagaagctttacgacacttacaaggcgcaaggtctcgtaattctcgac
ttcccgtgcaaccagttcggcgagcaagcacccggaacactcagcgaaataaaggctttt
tgcacgggaaactacggcgttactttcccacagttcgacaagatagaggtgaatggcaag
aaagaactgcccctttacacctatctgaaagcccaacaaggctttaaggggttcgatacg
aacaccaagataggcaagtttctcgacgaaaagttcagtaagcaagaccctaactatgcg
aaaaacccgagcatcaagtggaacttcaccaagttcttaatagaccgcgaaggccacgtt
gtagaccgtttcgagcctactgccgacatgaaagatgttgaggcgggcattcgtgctgcg
ctgaaagtgcagtaa

DBGET integrated database retrieval system