KEGG   Prevotella intermedia: PIN17_A0650Help
Entry
PIN17_A0650       CDS       T02058                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pit  Prevotella intermedia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pit00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:complement(662648..663397)
Genome map
AA seq 249 aa AA seqDB search
MIKKILISQPKPGSDKSPYYEIAKDLGVEMVFRPFFKVEGLSSKEFRQQKINLLDYTAVV
FTSRHAIDNYFKLAQEMRITIPETMKYFCVIETIALYIQKYTQYRKRKIFFGNSGKIDNL
IPTMVKHKDEKYLVPLSSVHTHSIGTMLTNNKLKHKECVMYRTISNDLTEEEKKTFDYDM
LVFFSPTGVRALKENLPDFEQGNIKIAAFGPATAKEVKDQGLRLDLEAPSAKYPSMTGAL
RAFLEEQKK
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaagatattaatatcacagcctaagccagggagcgacaagtcgccctattat
gaaatagccaaggatttgggcgtagaaatggtgtttcgcccattcttcaaggtggaaggc
ttatcgtctaaagagtttcgtcagcagaaaattaacttgcttgattacactgctgtggta
ttcacatctcgccacgccattgacaattactttaagttggcacaggaaatgcgtatcacc
attcctgaaacgatgaaatatttctgtgtgatagaaacgattgcgctctatattcagaaa
tatacgcagtacagaaagcgtaagattttctttggtaattcgggtaaaatagacaacctg
attcctacaatggtaaagcacaaggacgagaaatatcttgttccgttaagctcggtgcac
acccattccattggaacgatgctcacaaacaacaagctgaagcacaaggaatgtgtgatg
tatcgcaccattagcaacgaccttacagaggaagagaagaaaactttcgactacgatatg
cttgttttcttcagccctacgggtgttcgtgccttaaaagagaacttgcccgactttgaa
caaggcaacattaagatagctgcctttggtcctgcaacagccaaagaggtgaaagaccaa
ggtctgcgccttgacttggaggctccatcagctaaatatccttctatgacaggtgcgtta
cgtgccttcttggaagagcagaagaagtaa

DBGET integrated database retrieval system