KEGG   Prevotella intermedia: PIN17_A1083Help
Entry
PIN17_A1083       CDS       T02058                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA (EC:3.6.4.12)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pit  Prevotella intermedia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pit00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PIN17_A1083 (ruvA)
Enzymes [BR:pit01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PIN17_A1083 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:1101915..1102532
Genome map
AA seq 205 aa AA seqDB search
MIEYIKGELVELSPALAVVEAHGVGYGLNISLNTYSAIQGKQSVKLFVHEAIMTGGRDDN
YTLYGFATKQERSLYRLLITVSGVGANTARMILSSLTPAELCNVIANGDDKMLKTVKGIG
LKTAQRIIVDLKDKIVQSGIAEELHVSSQPATANVNNAVKDEAVGALTMLGFSPAPSAKV
VVAILTEQPDLPVEQVVKLALKQIK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgatagaatatataaagggtgaacttgtcgagctttcgccggcattggcagtcgtagaa
gcgcatggcgtgggctacggactgaacatttcgctgaatacttacagtgccattcaaggc
aagcaaagcgtaaagttgtttgtgcacgaagccattatgacgggtggacgcgacgataac
tatacgctttacggctttgccacaaagcaggaacgttcgctctaccgactgctcatcacc
gtgtcgggggtgggagcgaacaccgcacgtatgatactgtcgtcgctcacgcctgccgaa
ctgtgcaacgtgatagccaacggcgacgacaagatgctgaaaactgtaaagggcatcggg
ctgaagacggcacaacgcatcatcgtagacttgaaagacaagatagtgcaaagcggtata
gccgaagaattgcacgtcagcagccaaccagccacggcgaacgtaaacaacgctgtaaaa
gacgaagcagtgggagcactcacgatgttgggcttctcgcccgcaccatcggcaaaggtt
gtagtagccatcttgaccgaacagcccgatttaccagtggaacaagtggtgaaattagcg
ttgaagcaaataaaatag

DBGET integrated database retrieval system