KEGG   Prevotella intermedia: PIN17_A1295Help
Entry
PIN17_A1295       CDS       T02058                                 

Gene name
mscL
Definition
large conductance mechanosensitive channel protein
Orthology
K03282  
large conductance mechanosensitive channel
Organism
pit  Prevotella intermedia
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:1340990..1341370
Genome map
AA seq 126 aa AA seqDB search
MAFIKEFKEFAMRGNVMDMAVGVIIGGAFGKIVSSLVDDVMMPIIGVLTGGVDFSKVSIM
VGDAEVKYGMFIQNVIDFLIIAVCIFAMIKGMNSLSKKKEEEPAAPTEPSNEEKLLGEIR
DLLKNK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcttttattaaagagttcaaggaatttgccatgcgtggtaacgtaatggacatggct
gtcggtgttatcattggtggcgcgtttggaaagattgtatcttcgttggtagacgatgtt
atgatgccgattatcggtgtgctgacaggtggcgtagacttcagcaaagtgagcataatg
gtaggcgatgctgaagttaagtatggtatgttcattcagaatgtcatcgacttccttatc
atcgcagtttgtatctttgcaatgattaagggtatgaacagtctttcaaagaagaaggaa
gaagaaccagctgcacctacagagccttctaatgaagaaaagttgcttggcgaaattcgt
gatttgttgaagaacaagtaa

DBGET integrated database retrieval system