KEGG   Prevotella intermedia: PIN17_A1295Help
Entry
PIN17_A1295       CDS       T02058                                 

Gene name
mscL
Definition
large conductance mechanosensitive channel protein
Orthology
K03282  
large conductance mechanosensitive channel
Organism
pit  Prevotella intermedia
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:1340990..1341370
Genome map
AA seq 126 aa AA seqDB search
MAFIKEFKEFAMRGNVMDMAVGVIIGGAFGKIVSSLVDDVMMPIIGVLTGGVDFSKVSIM
VGDAEVKYGMFIQNVIDFLIIAVCIFAMIKGMNSLSKKKEEEPAAPTEPSNEEKLLGEIR
DLLKNK
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcttttattaaagagttcaaggaatttgccatgcgtggtaacgtaatggacatggct
gtcggtgttatcattggtggcgcgtttggaaagattgtatcttcgttggtagacgatgtt
atgatgccgattatcggtgtgctgacaggtggcgtagacttcagcaaagtgagcataatg
gtaggcgatgctgaagttaagtatggtatgttcattcagaatgtcatcgacttccttatc
atcgcagtttgtatctttgcaatgattaagggtatgaacagtctttcaaagaagaaggaa
gaagaaccagctgcacctacagagccttctaatgaagaaaagttgcttggcgaaattcgt
gatttgttgaagaacaagtaa

DBGET integrated database retrieval system