KEGG   Prevotella intermedia: PIN17_A1406Help
Entry
PIN17_A1406       CDS       T02058                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pit  Prevotella intermedia
Pathway
pit00480  Glutathione metabolism
pit00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pit00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PIN17_A1406
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PIN17_A1406
Enzymes [BR:pit01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PIN17_A1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFJ09268
UniProt: I1YVX9
Position
II:complement(1455677..1456231)
Genome map
AA seq 184 aa AA seqDB search
MKTVYDFTVKDRKGGDISLKAFANEVLLIVNTATKCGFTPTYDELEATYKKYHSQGFEVL
DFPCNQFGQQAPGTDESIHQFCKLTYGTNFPRFKKIKVNGEDADPLYKFLKEQKGFAGWD
ESHKLTPILDKMLSEADPDYKEKSDIKWNFTKFLINKKGQVIARFEPTEKIENIEKEIEK
LLAE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtttatgatttcactgtcaaagacagaaaaggcggtgatatttctttaaaa
gcgtttgccaacgaagtgctgttaattgtaaatacagctacaaaatgtgggttcacacca
acttacgatgaactcgaagctacttacaaaaagtatcattcacagggctttgaagtgctc
gatttcccttgcaaccaatttggacagcaggctccgggaaccgacgagagcattcaccag
ttctgtaaacttacatacggcactaacttcccacgcttcaagaagattaaagtaaacggc
gaagatgctgacccgctttacaaattcttgaaagaacaaaagggttttgcaggttgggac
gaaagccacaagctcacacctatactcgacaagatgttgtcagaggctgacccagactac
aaagagaagtcggacattaagtggaacttcacaaaattccttatcaacaagaaaggtcaa
gttattgcacgcttcgaaccaactgaaaagatagagaacattgagaaggaaatagagaag
ttgctcgcagaataa

DBGET integrated database retrieval system