KEGG   Prevotella intermedia: PIN17_A1406Help
Entry
PIN17_A1406       CDS       T02058                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pit  Prevotella intermedia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pit00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pit00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:complement(1455677..1456231)
Genome map
AA seq 184 aa AA seqDB search
MKTVYDFTVKDRKGGDISLKAFANEVLLIVNTATKCGFTPTYDELEATYKKYHSQGFEVL
DFPCNQFGQQAPGTDESIHQFCKLTYGTNFPRFKKIKVNGEDADPLYKFLKEQKGFAGWD
ESHKLTPILDKMLSEADPDYKEKSDIKWNFTKFLINKKGQVIARFEPTEKIENIEKEIEK
LLAE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagtttatgatttcactgtcaaagacagaaaaggcggtgatatttctttaaaa
gcgtttgccaacgaagtgctgttaattgtaaatacagctacaaaatgtgggttcacacca
acttacgatgaactcgaagctacttacaaaaagtatcattcacagggctttgaagtgctc
gatttcccttgcaaccaatttggacagcaggctccgggaaccgacgagagcattcaccag
ttctgtaaacttacatacggcactaacttcccacgcttcaagaagattaaagtaaacggc
gaagatgctgacccgctttacaaattcttgaaagaacaaaagggttttgcaggttgggac
gaaagccacaagctcacacctatactcgacaagatgttgtcagaggctgacccagactac
aaagagaagtcggacattaagtggaacttcacaaaattccttatcaacaagaaaggtcaa
gttattgcacgcttcgaaccaactgaaaagatagagaacattgagaaggaaatagagaag
ttgctcgcagaataa

DBGET integrated database retrieval system