KEGG   Prevotella intermedia: PIN17_A1494Help
Entry
PIN17_A1494       CDS       T02058                                 

Definition
firmicute fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
pit  Prevotella intermedia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PIN17_A1494
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PIN17_A1494
   00030 Pentose phosphate pathway
    PIN17_A1494
   00051 Fructose and mannose metabolism
    PIN17_A1494
  Energy metabolism
   00680 Methane metabolism
    PIN17_A1494
Enzymes [BR:pit01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     PIN17_A1494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:complement(1548196..1550208)
Genome map
AA seq 670 aa AA seqDB search
MTNETYDLKKDERYLQLLSQSFPTIADASTEIINLQAILNLPKGTEHFLADIHGEHEAFQ
HVLKNASGNIKRKVNDLFGDTLRESEKRDLCTLIYYPERKIELVKKAESDIEDWYHIAIH
RLVRICRDVSSKYTRSKVRKSLPIEFSYIIQELLHESSADKDKTDYVSTIISTIISTGRA
DDFITTICNVIQRLAIDHLHILGDIYDRGPGAHVVMDILRNYHTWDITWGNHDILWAGAC
AGNDACICNVIRIALRYDNMDTIEDGYGINLMQLATFAMDVYGDDPCIEFMPKVTNPEKV
DDKSILLIARMHKAISVIQFKIEAQMIKKYPHWKMNHRLLFEMIDYKKGTITIGGKEYKL
TSCNFPTVDPKHPEKLTQEEQALMERLHHSFTVSEKLREHILLQLRHGCMYKVVNNNLLY
HASIPLNEDGTLREVEIEPKNFAKGKDLLHKVGMIIRRAFQSQTTVERSKMYEYAVDYFL
YLWCGPDSPLFDKAAMTTFERYFIKEKETHHEEKGFYFKFREREDIADMIMEEFGVNSAT
GHIINGHVPVHVNKGEKPIKANGKLMVIDGGFSEAYHKETGIAGYTLIYHSRGFELVQHE
PFASEEDAITRGIDIVGTTQIVELNQRRLKVADMDKGTELKLQIEALEELLYAYRHGFLA
ESEKKNPPKM
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgaaacttatgatttaaagaaagacgaacgctatttgcagttgctgtctcaa
tcgtttccaacaattgcagatgcaagtacggaaatcataaacttgcaggctatattgaat
ttgccaaagggcacagagcacttcttggcagacattcacggcgaacacgaagcattccaa
cacgtcttgaagaatgcgtcgggaaacattaagagaaaggtgaacgacctttttggcgat
acgctgcgcgagtcggaaaagcgagacctttgcacactcatttattatcccgagcgaaag
attgagcttgtgaagaaagcggaaagcgatatagaagattggtatcatattgccattcac
cgtctggtcagaatatgccgagatgtttcaagcaaatacacaaggtctaaagtgcgcaag
tcgctccctatcgaattttcttatatcattcaggaacttttgcacgaaagttctgccgac
aaggacaagacggattatgtcagcacgattatttcgacgattatctcaacaggcagagct
gatgactttatcacaacgatttgtaatgtcattcagcgtcttgccatcgaccatctgcat
attttgggcgatatatacgaccgcggtcccggcgcacacgtcgttatggatattttaaga
aactaccatacatgggatataacttgggggaatcacgacatattgtgggcaggagcctgt
gccggtaacgatgcctgcatttgcaacgtgataagaattgccctgcgatacgacaatatg
gacaccattgaggacggttacggtataaacctaatgcagctggcaactttcgcaatggac
gtttacggcgacgacccttgcattgaatttatgccgaaagttacaaatcccgaaaaggtt
gacgacaagagcatattgcttattgcacgtatgcacaaggcaattagcgtaattcaattc
aagattgaggcgcagatgataaagaaatatcctcattggaagatgaatcatcgcttgttg
tttgaaatgatagactacaagaaagggactataaccattggtggcaaggagtataaactt
acatcgtgcaacttccctacggtagaccccaagcacccagaaaaactcacgcaggaggaa
caagcattgatggaacgactccatcattcgtttactgtgagcgaaaagctgcgcgagcac
attcttctccagcttcgccacggttgtatgtataaggtggtaaacaacaacctgctttac
cacgcctctattccattgaacgaagacggtacgttgcgtgaggttgaaatcgaaccaaag
aactttgccaaaggtaaagaccttctacacaaggtgggaatgattatccgccgtgctttc
caatcgcaaaccaccgtagagcgcagcaagatgtacgagtatgccgttgactatttcctt
tatctgtggtgcggtcccgatagtccgcttttcgacaaggctgccatgacaaccttcgaa
cgctacttcatcaaggagaaggaaacacatcacgaagagaaagggttctacttcaagttc
cgcgagcgtgaggacatcgccgatatgattatggaagagtttggcgtgaacagtgccacg
ggacatattatcaacggccacgtccctgtccatgtaaacaagggcgaaaaacccatcaaa
gccaatggaaaacttatggtcatcgatggtggtttctcggaggcttaccataaagagaca
ggtattgcaggctacacgcttatctaccactctcgcggcttcgaacttgttcagcacgaa
ccatttgcatcggaagaagatgctattacccgtggtatcgacatcgttggtactacacag
attgtagagttgaaccaacgccgtttgaaagtagctgatatggataaaggtacagagctg
aaacttcaaatcgaggctttggaagaattgctctatgcgtatcgccatggctttttggca
gaaagcgaaaagaaaaacccaccaaaaatgtaa

DBGET integrated database retrieval system