KEGG   Prevotella intermedia: PIN17_A1506Help
Entry
PIN17_A1506       CDS       T02058                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pit  Prevotella intermedia
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pit00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:pit00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:complement(1561131..1561619)
Genome map
AA seq 162 aa AA seqDB search
MKINIIAAVAKNRAIGYNNDMVYFIKEDLRRFKELTTGHTVIMGRRTFHSLPKGALPNRR
NIVLSRTESDFPGCDVYTSLNEALKHIADNEEAFIIGGASLYKEGLAIADRLYLTEIEAI
PPHADVFFPEYNDGTWEVETRQERPETADTPAYAYVDYVRKK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaacattatagcagcagtggcaaagaaccgtgccatcggttacaacaacgat
atggtctacttcattaaagaagacctgcgtagatttaaagaacttacaacaggacacacc
gttattatggggcggcgcacattccactcgctccctaaaggagcattgcccaatcgcagg
aatatcgtactgagccgcactgaaagcgacttcccaggttgcgatgtctacacctctctc
aacgaggctttaaagcacattgccgataacgaagaagctttcatcataggtggcgcaagt
ctgtacaaagaaggtttagctattgccgaccgcctctacctaaccgaaatagaggctatt
ccgccccatgccgatgtttttttcccagaatataatgatggcacatgggaagtggaaaca
agacaagaacgtcccgaaactgccgacactcctgcttacgcatatgtagactacgttaga
aagaaataa

DBGET integrated database retrieval system