KEGG   Prevotella intermedia: PIN17_A1532Help
Entry
PIN17_A1532       CDS       T02058                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pit  Prevotella intermedia
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pit03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:1596850..1597458
Genome map
AA seq 202 aa AA seqDB search
MQQFPSQLLEKAVGEFSKLPGVGRKTALRFVLHLLRESKDDVDGFTEAISTMRHDIKYCH
ICHNISDTDTCFICANPHRDASTLCVVENVQDVLAIENTQQYNGLYHVLGGIISPIDGIG
PNDLEIESLVERVKTGEVKEVILALASTMEGDTTNFYISRKLKGVDVKLTVIARGISVGD
ELEYTDEVTLGRSILNRTIIEG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaatttccttctcaactgcttgaaaaggctgttggagagttttctaagttaccg
ggagtaggtcgaaaaactgctctccggtttgttttgcatctattacgcgaatctaaagat
gatgtagatggcttcacagaggctatttctacaatgcggcatgatattaaatactgccat
atttgccacaatatttccgacactgacacatgtttcatttgcgcaaatccacatagggac
gcttcaacgttgtgtgttgtagagaatgtgcaagatgttcttgccatcgagaatactcag
caatacaatggtttgtaccatgtgttgggtggaataatctcaccaatagatggtatcgga
ccaaacgatttggaaatagaatcgcttgtagaacgagtgaaaacgggtgaagttaaagag
gttattcttgctttagcgagcacgatggaaggcgatacaacaaacttttatatatcgcgc
aagctgaaaggtgttgatgtaaagctaactgtaatagctcgtggcatatcggttggcgat
gaattggaatacaccgatgaagttacattgggacgaagcatactgaatagaacaataata
gaaggttaa

DBGET integrated database retrieval system