KEGG   Prevotella intermedia: PIN17_A1726Help
Entry
PIN17_A1726       CDS       T02058                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pit  Prevotella intermedia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pit00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PIN17_A1726 (pfkA)
   01230 Biosynthesis of amino acids
    PIN17_A1726 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PIN17_A1726 (pfkA)
   00030 Pentose phosphate pathway
    PIN17_A1726 (pfkA)
   00051 Fructose and mannose metabolism
    PIN17_A1726 (pfkA)
   00052 Galactose metabolism
    PIN17_A1726 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    PIN17_A1726 (pfkA)
Enzymes [BR:pit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PIN17_A1726 (pfkA)
Protein phosphatases and associated proteins [BR:pit01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PIN17_A1726 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:complement(1782356..1783333)
Genome map
AA seq 325 aa AA seqDB search
MAKVKTIGILTSGGDAPGMNAAVRAVTRTGIYNGFSIKGIYRGYDGLLTGDIKTFTTENV
SGIIDEGGTILKTARSKAFMTKEGKEKAYENIVKEGIDALVVIGGNGSLTGAMNFAQEYD
LCCIGLPGTIDNDLYGTDSTIGYDTTLNTIMECVDRIRDTAQSHERIFFVEVMGRDAGFL
AQNSAIASGAEAAIIPEDSTDVDQLARFMERGIRKSKKSCIVVVSESPKCGAMYYADRVK
KEFPNFDVRVSILGHLQRGGRPSARDRILASRTGYGAIEAIMQGQRNIMVGVRNNEVVYV
PLSEAIRSDKPFDKKLIKILDVLSI
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggtcaaaacaattggtattttaacttcgggcggcgacgctccgggtatgaat
gctgccgttagagctgttactcgtactggaatttacaatgggttttctataaaaggaatc
taccgtggatatgatgggttgcttactggagatataaagacatttacaacagaaaatgta
agtggcattattgatgaaggtggaaccatcttaaagacggctcggtcgaaagcctttatg
accaaagaaggcaaggagaaagcctatgagaatattgtaaaggaaggaattgacgcactt
gtagtaatcggaggaaacggttctttgacaggagcaatgaactttgctcaggagtatgac
ctttgttgcataggtttgccgggcacaatagataacgacctctatggaacggatagcacc
ataggttacgatacaaccttaaacacaataatggagtgcgtggacagaatacgcgatacg
gcgcaaagccacgagcgcatcttctttgtggaagtaatggggcgcgacgctggtttccta
gcacaaaattcggcaatagcaagtggtgctgaggctgcaatcattcctgaagactcaacc
gatgtagaccagttggctcgatttatggagcgtggtattcggaagtcaaagaaaagttgt
attgttgtggtgtcagaaagtcccaaatgcggtgctatgtattatgctgaccgtgtaaag
aaagagtttccaaacttcgatgttcgtgtttcgatacttggacacttgcaaagaggagga
cgaccatcggcacgcgacagaatacttgcaagcagaacaggctatggcgcaatagaagcc
ataatgcaaggacagcgaaatataatggtaggagttcgcaataatgaggtggtttatgtg
ccgctttcagaagctattcgctccgataaacctttcgacaagaaacttattaaaatcttg
gacgtgcttagtatataa

DBGET integrated database retrieval system