KEGG   Prevotella intermedia: PIN17_A1821Help
Entry
PIN17_A1821       CDS       T02058                                 

Definition
aldose 1-epimerase domain protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pit  Prevotella intermedia
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pit00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PIN17_A1821
   00052 Galactose metabolism
    PIN17_A1821
Enzymes [BR:pit01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PIN17_A1821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
II:complement(1890494..1891450)
Genome map
AA seq 318 aa AA seqDB search
MKHLSFAIIACFFSLVLSAQDIQTFQLINDTGMKALVSNYGARLMQLEAYNWNGRLEPVI
KGYKHISDYKDNTMLGATMMSLDGKVSPALADKVWEVVSADHQSVTFRYIADSKEGEFDG
KMNFSVTYTLSDQNALDIDYRMTSTAPTRYKLTNGIVFNLSGDPTRSILKQHLWIDSHKT
NVFDKDMRLTGEQENVRFTPLNFIQPRELGERINDLQNGYNHAFQLRHPANVQKPAAILF
DEQSGRVLTVYTYEPTLRINSYGKNSTGISFQPLHTGYNDDKEKIGTNINPGQVFHAATV
FIFTTDPPLIMRRERATE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacctaagctttgccataatagcttgttttttctctcttgtgctatcggcgcaa
gatatacaaacctttcagttaataaacgatacgggtatgaaagccttggtaagcaactac
ggcgcacgtcttatgcagctcgaagcatataactggaatggaagattggaacctgtaata
aaaggctataaacatatatccgactacaaagacaacacgatgcttggtgcaacgatgatg
agtcttgacggaaaagtaagtcctgcgttggcggataaggtctgggaagtagtcagtgcc
gaccaccaatccgtgacttttcgttatattgcagacagcaaagagggcgagtttgatggc
aaaatgaacttctcggtaacctatacgctgtccgaccaaaacgcacttgatattgattac
agaatgacttccactgccccaacacgctataaacttaccaacggtatcgttttcaacctg
tcgggcgaccccactcgctctattctaaagcagcatttgtggatagattcgcataaaacg
aacgtgttcgataaggatatgcgacttacgggtgagcaggaaaacgtgcggtttacgccg
ttgaacttcattcaaccgagggaattgggcgagcgcatcaacgatttgcagaatggatac
aaccacgcttttcagctgcgacaccctgccaacgtgcagaaacccgctgccattcttttc
gatgagcagagcggcagagtgctgacggtttatacatacgaaccaactttacgcataaac
tcgtatggtaaaaacagtacgggcatttctttccaaccccttcatacgggctacaatgat
gataaggaaaagataggtacaaatattaatccgggacaggtattccacgctgcaacggtg
tttatcttcaccaccgaccctcccttgataatgaggagagagcgtgccactgaataa

DBGET integrated database retrieval system