KEGG   Prevotella intermedia: PIN17_A1889Help
Entry
PIN17_A1889       CDS       T02058                                 

Gene name
folK_1
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pit  Prevotella intermedia
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pit00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:1971210..1971539
Genome map
AA seq 109 aa AA seqDB search
MKITISLGSNTEQEQHIEEAIERLKTVFSDITFTQPQWTEPIGVVSDRYLNCLANFTTSL
SLQQLVQQLKNIETAMGDTHENHKQGIVLIDLDVIKYGDKEVKKIAWLQ
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgaagataacaatatcgcttggctcgaataccgagcaagaacagcatatagaagaagcc
attgaaagactgaaaactgtgttttcggatataactttcacacaaccgcagtggaccgaa
cccattggtgtcgtatcggacagatacttgaattgcttggctaacttcaccacatcgctt
tcgttgcagcagctcgtacaacagctgaagaacattgaaacagcaatgggcgacacgcac
gaaaaccacaagcaaggcattgtgctgatagacttagatgttataaaatatggagataag
gaggttaagaagattgcttggctgcaataa

DBGET integrated database retrieval system