KEGG   Prevotella intermedia: PIN17_A1921Help
Entry
PIN17_A1921       CDS       T02058                                 

Gene name
folK_2
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pit  Prevotella intermedia
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pit00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PIN17_A1921 (folK_2)
Enzymes [BR:pit01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PIN17_A1921 (folK_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
II:complement(2002626..2003036)
Genome map
AA seq 136 aa AA seqDB search
MQHTVYLGLGSNLGNRKAILNEAISLIQNRVGEVVRQSSFLETEPWGFESPNNFLNVCLC
VDTQHAPRQLLETTQAIEKEMGRSHKTVNRKYQDRIIDIDILMIDDLKISEPDLKVPHPL
MEERDFVMIPLKEIMP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacacagtgtatcttgggttaggctctaaccttggcaaccgtaaggctatctta
aacgaagctatttctcttattcagaacagagtaggagaggtggttcgacagtcgtcgttc
ctcgaaactgaaccttggggctttgaaagtcctaacaacttcctcaatgtttgcttatgt
gtagatacacagcacgcaccccgtcagctgttagaaaccacgcaagccattgagaaagaa
atgggacgtagtcataaaaccgttaatcgcaagtatcaagaccgcatcattgatattgac
attctgatgattgacgaccttaaaatcagtgaacccgacctcaaagtgccacacccttta
atggaagaacgcgactttgtgatgattcctttaaaggaaattatgccgtaa

DBGET integrated database retrieval system