KEGG   Paenibacillus sp. JDR-2: Pjdr2_0045Help
Entry
Pjdr2_0045        CDS       T00977                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pjd00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:pjd00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pjd00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
48200..49498
Genome map
AA seq 432 aa AA seqDB search
MSKITFLGAGSTVFAKNVLGDVMLTEPLQGFELALFDIDAGRLRDSEQLLLNMKQSLGSN
CVVKAYSDRKEALRGAKYVINAIQVGGYDPCTITDFEIPKKYGLRQTIADTVGIGGIFRN
LRTIPVVLDFAKDMREVCPDALFMNYTNPMAVLTNVLSTAGGVRTVGLCHSVQACVSDLF
KSLEMDATGVESKIAGINHMAWLLEVKKDGVDLYPEIKRRAAEKQKEKHHDMVRFEMMLK
FGYYITESSEHNAEYHPYFIKRNYPELVDRFNIPLDEYPRRCIEQIKGWNSMRESLLANS
NIEHKRSHEYASHIMEAIETGKTFKIGGNVMNTGLITNLPKEACVEVPCLVDRSGINPTY
VGDLPPQLAALNRTNINTQLLTIEAALTQKKEHIYHAAMLDPHTSAELSMDDIVALCDDL
IEAHGDWLPAYK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaattacttttctaggtgcgggaagcacggtgttcgcgaaaaatgtactgggt
gacgtaatgttaacggagccgctgcaaggctttgagcttgccttattcgatattgatgca
gggcgtctgcgcgattccgagcagctgctgttgaatatgaaacaatcgcttggcagcaac
tgtgtggttaaagcttattctgaccgcaaagaagcgctccgcggagcgaaatatgtaatc
aacgctattcaagttggcggctacgatccttgtacgatcacggattttgaaattccgaaa
aaatacgggctgcgccagacgattgccgatacggttggcatcggcggtattttccgtaac
ctgcgcacgattccggttgtgcttgattttgcaaaggatatgcgcgaggtttgtccggac
gccctattcatgaactatacgaatccgatggcggttctgacgaatgtgctgtcgacggcg
ggcggcgttagaacggttggcttgtgccacagcgtacaggcctgcgtgtccgatctgttc
aaaagcctggagatggacgctacgggcgtggaatccaagattgcgggcatcaaccatatg
gcctggctgcttgaagtgaagaaggatggcgtggatctgtatccggagatcaagcgccgt
gcggcggaaaagcagaaggagaagcatcatgacatggtacgcttcgaaatgatgctgaag
ttcggctactacattacggaatcgtcggagcataatgcagagtaccatccgtatttcatt
aaacgcaattatccggagctggttgaccgcttcaacattccgctggacgaatacccgcgc
cgctgcatcgagcagatcaaaggctggaacagcatgcgggaatcgctgctcgcgaacagc
aatatcgagcataagcgcagccatgagtacgcatcgcatatcatggaagcgattgaaacg
ggcaaaacgttcaaaatcggcggcaacgtcatgaacaccggcctgattaccaacttgccg
aaggaagcttgcgtagaggttccgtgccttgttgaccgctcgggcatcaatccgacgtat
gtcggcgatctgccgccgcagctggctgcgctcaaccgcacgaacatcaatacgcagctg
ttgacgattgaagcagcgctgacgcagaagaaagagcatatctaccatgccgctatgctg
gatcctcatacttcggcggagctgtccatggatgatattgtggctttgtgcgacgatttg
atcgaggctcatggtgattggctgcctgcatataagtga

DBGET integrated database retrieval system