KEGG   Paenibacillus sp. JDR-2: Pjdr2_0080Help
Entry
Pjdr2_0080        CDS       T00977                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pjdr2_0080
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pjdr2_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
84527..85078
Genome map
AA seq 183 aa AA seqDB search
MGVLSVPNTLAEAYIALGSNLNDREELLQQAVEHLRQQSGVQVLGISGIYETDPVGYTDQ
PAFLNMAMAVKTTLSPIELLHVLFKVEQLLGRVRDIRWGPRTIDLDLLLYGDVTMDDEEL
TLPHPRMMERAFVLVPLADVIDSSHPLQDRVSNTAAAALQDGKEGITLWKITNWLSGSGH
SGS
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgttgtccgtgcctaacaccttggcggaggcgtacattgctctaggctccaac
cttaacgatcgcgaggaactgcttcagcaggcggtggaacacctccggcagcagtctggc
gttcaagttttagggatatccggtatttacgagactgaccctgtcgggtatacggatcag
ccggcttttctgaatatggcgatggccgttaagactacactttcacccatcgagcttctt
cacgtgttattcaaagtggagcagcttctcggacgcgtaagggatatacgctggggaccg
cgcaccatagatctagatctgctgttatatggagatgttacgatggatgacgaggagctg
acgcttcctcatccccgtatgatggagcgggctttcgtgcttgttccgcttgcggatgtc
atcgattcgtcgcatcctctgcaggaccgtgtttcgaatactgcagcagcggcgcttcag
gatggaaaggaaggcatcacgttatggaaaatcaccaattggctcagcgggtccgggcat
tccggaagctga

DBGET integrated database retrieval system