KEGG   Paenibacillus sp. JDR-2: Pjdr2_0146Help
Entry
Pjdr2_0146        CDS       T00977                                 

Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pjdr2_0146
DNA repair and recombination proteins [BR:pjd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pjdr2_0146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
157179..157778
Genome map
AA seq 199 aa AA seqDB search
MFYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLRMKEDDVIDFAKALVSVKRNLTYCSVC
CNITDTDPCRICQDKTRDNSVICVVQESKDLVAMERTKEFQGFYHVLQGAISPIEGIGPD
QIKIAELLRRLSDERVQELILATNPNIEGEATAMYISRLVKPFGIRVTRIAHGLPVGGDL
EYADEVTLSKALEGRRELR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgttttatcccgaaccgatagcgaagcttattgatgcctttacgcggcttccgggcgtt
ggaccgaagacagccgcacgattggcttttcatgtgcttcgtatgaaagaagatgatgtc
atcgatttcgctaaggcgcttgtcagcgttaagcggaatctgacgtactgctccgtctgc
tgcaatattaccgataccgatccatgccggatttgccaggataaaacgcgcgataactcc
gttatttgtgtggttcaggaatcgaaggatcttgtggccatggaacggacgaaggaattt
caaggattttaccacgtgcttcaaggtgctatttcccctattgagggaattgggccggat
cagatcaagatagcggagctgctccggcgtttgagcgatgagcgtgtgcaggagctgatc
ttggcgacgaatccgaatattgaaggcgaagcgaccgcgatgtacatctcgaggcttgtc
aaaccgtttggaatccgcgtaacgcggatcgcccacggcttgccggttggcggcgatctt
gaatatgccgatgaggttaccttgtccaaagcgcttgaaggacgcagagagctgcgctaa

DBGET integrated database retrieval system