KEGG   Paenibacillus sp. JDR-2: Pjdr2_0161Help
Entry
Pjdr2_0161        CDS       T00977                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pjdr2_0161
  Amino acid metabolism
   00340 Histidine metabolism
    Pjdr2_0161
Enzymes [BR:pjd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Pjdr2_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
176140..177429
Genome map
AA seq 429 aa AA seqDB search
MRIMKAEQFGLQREVEYGTPEQNETVRQIVEAIKEEGDAALLAYTEQLDRVRLDASSLRV
TQEEINAAYDRVDAAFLTAIREAAVNIRVFHEKQMRNSWMDLQPDGTMLGQILRPLKRVG
VYVPGGKAAYPSSVLMNVIPAQVAGVPEIVMVTPPATGGKEGIDPYILVAAAEAGVKEMY
RVGGAQAIAALAYGTATIAPVDKICGPGNIYVALAKRTVFGAVDIDSIAGPSEIVVLADE
GANASYIAADLLSQAEHDEMASAILVTPSETLAEAVAAEVERQISTLPREAIARASIDSY
GAVLLVESIEAGIDVVNKLAPEHLEVLTADPMSLLGLIENAGAIFLGPYSSEPVGDYFAG
PNHIIPTNGTARFSSPVNVDDFLKKSSLIYYSKEALLKNGSSIMTLARHEGLEAHARAIQ
IRLEQEGNQ
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcggataatgaaggcggagcaatttgggcttcagcgcgaggtggagtacggaacaccg
gagcaaaatgaaacggtccgtcagatcgtcgaagcgatcaaggaggaaggggacgcggcg
ctgcttgcgtatacggagcagctggaccgcgtccggcttgatgcgtcgtcgctccgcgtg
acgcaggaagagatcaatgcggcgtacgatcgggtagacgccgcgttcctcacggcaatc
cgcgaggcagccgtgaatattcgcgtattccacgagaagcagatgcgtaactcgtggatg
gatctgcagccggacggtacgatgctcgggcaaattctccggccgctgaagcgggtcggc
gtatacgtgcccggcggtaaggcggcgtacccgtcgtccgtgctgatgaacgtcattccg
gcgcaagtagccggcgtgccggaaattgtaatggtgacgccgcctgcaaccggcggcaag
gaaggcatcgacccgtatattctcgttgccgccgcggaagcgggcgtgaaggaaatgtac
cgggtcggcggcgcgcaagcgattgccgcactcgcatacggcacggcaacgattgctccg
gtcgataagatttgcggaccgggcaacatctatgtcgcgctggcgaagcggacggtattc
ggcgcagttgacatcgacagcattgcaggcccaagcgaaattgtcgtgctggccgacgaa
ggcgccaacgcctcgtatatcgcggctgatctgctgtcgcaggcggagcatgacgagatg
gcatcggcaatcctagtaacgccttcggagacgctcgcagaggcggttgccgccgaggtg
gagcgccagatctccactctgccgcgcgaagcaatcgcgcgggcatccattgacagctat
ggcgctgtgctgctcgtggaatcgatcgaagcaggcattgacgtcgtaaacaagctggcg
ccggagcacttggaagtgctgacggccgatccgatgagtctccttggcttgatcgagaat
gccggcgcgattttcctcggaccatacagctcggaaccggttggcgattattttgccgga
cctaaccatatcatcccgacgaacggaaccgcacgcttctcctcgccggtgaacgtggac
gatttcctgaagaagtcgagccttatctactacagcaaggaagcgctgttgaagaacggc
agcagcattatgacgcttgcgcgtcatgaagggctggaggcgcatgcccgcgccattcag
attcgtctggagcaggaaggcaatcaatag

DBGET integrated database retrieval system