KEGG   Paenibacillus sp. JDR-2: Pjdr2_0163Help
Entry
Pjdr2_0163        CDS       T00977                                 

Gene name
hisH
Definition
imidazole glycerol phosphate synthase subunit HisH
Orthology
K02501  
glutamine amidotransferase [EC:2.4.2.-]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pjd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pjd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
178069..178692
Genome map
AA seq 207 aa AA seqDB search
MIAIIDYGMGNLHSVSKAVERLGYEAVVTADPAVIASADGAILPGVGAFGDAMENLRETK
LDEVTKAYAASGKPLLGICLGMQLLFSESEEHGVNEGLNLLPGKVIRFQGDYKVPHMGWN
KLSFLQSDSPLFKGLEEGHVYFVHSFHAKPEVASDLLATTDYYQQVTAIVGRGNVHGMQF
HPEKSSDLGIKLLGNFLALTGSPVAQR
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgatcatcgattacggcatgggcaatctgcacagcgtcagcaaagctgtcgaa
cgccttggttatgaagcggtagtaacggctgatccggccgttatcgcttcggcggacgga
gcgatcctcccgggcgttggcgcgtttggggatgctatggagaatcttcgcgagacgaag
ctggatgaagtgacgaaagcttacgcagcatccggcaagccgctgctaggcatctgtctc
ggtatgcagctcttgttcagcgaaagcgaagagcatggcgtaaacgagggcttgaacctg
ctcccaggcaaggtcattcgcttccaaggcgattacaaagtgccgcatatgggctggaac
aagctgagtttcctgcagtccgacagtccgctgtttaaaggtctcgaggaaggtcatgta
tacttcgtacactctttccacgcgaaacccgaggtcgccagcgaccttctggcaacaacg
gattactatcagcaggtaacggctattgtcggcaggggcaacgtgcatggcatgcaattc
catccggagaaaagcagcgaccttggcatcaagctgcttggcaacttccttgctttaaca
ggtagcccggtagcgcagcgataa

DBGET integrated database retrieval system