KEGG   Paenibacillus sp. JDR-2: Pjdr2_0170Help
Entry
Pjdr2_0170        CDS       T00977                                 

Definition
(GenBank) glucokinase, ROK family
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00010  Glycolysis / Gluconeogenesis
pjd00052  Galactose metabolism
pjd00500  Starch and sucrose metabolism
pjd00520  Amino sugar and nucleotide sugar metabolism
pjd00521  Streptomycin biosynthesis
pjd01100  Metabolic pathways
pjd01110  Biosynthesis of secondary metabolites
pjd01120  Microbial metabolism in diverse environments
pjd01130  Biosynthesis of antibiotics
pjd01200  Carbon metabolism
Module
pjd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pjd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_0170
   00052 Galactose metabolism
    Pjdr2_0170
   00500 Starch and sucrose metabolism
    Pjdr2_0170
   00520 Amino sugar and nucleotide sugar metabolism
    Pjdr2_0170
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pjdr2_0170
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pjdr2_0170
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pjdr2_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG FGGY_N
Motif
Other DBs
NCBI-ProteinID: ACS98850
JGI: Pjdr2_0170
UniProt: C6CSW1
Position
185512..186462
Genome map
AA seq 316 aa AA seqDB search
MSEKIYVGVDVGGTAIKVGICNVEGELLHTYEGPTETSKGTDTILHNIAQYARNIVTESP
FDWEQVEGVGVGIAGFLDIPNGIVKFSGNLKIENVHLKEYLEEELQVKVLVNNDANVAAL
GEAWAGAGKGIDNCVCYTLGTGVGGGIIIGGKIVEGFAGMAGELGHIAIVPDLEAIQCGC
GKMGCLESVSSATGIIRMAKDAVERGDRTVLSTVEDIMAKDVIDAAKAGDEVASRIVSRA
AYYLGKSMALMAVVLNPECFIIGGGVSKAGDFLFDQIREVFEKYTQKEAQEGVKIVAATL
GNNAGVVGAAGLILRS
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagaagatttacgttggagtcgatgtcggcggcaccgctattaaagttgggatt
tgtaacgtggagggagaattgctccatacttacgaagggccgacggaaacgagtaaaggt
acggacaccatccttcataatattgcgcagtatgcgcggaacatcgtgaccgaatcgccg
tttgattgggagcaagttgaaggcgttggcgtagggatcgccggcttccttgatatcccg
aacggtattgtgaaattttcgggcaacttgaagattgagaatgttcacttgaaggaatat
ctcgaggaggagcttcaagttaaagtccttgttaataatgacgcaaacgttgccgcgctt
ggcgaagcgtgggccggtgctggcaaaggcatcgataactgcgtctgctatacactggga
actggcgtaggcggcggtattattatcggcggcaaaatcgtagagggcttcgcgggtatg
gccggcgagctgggccacatcgcgattgttcctgatctggaagcgattcaatgcggctgc
ggcaaaatgggctgtctcgaatcggtatcctccgctacgggtattatccgcatggcgaag
gatgctgttgagcgcggagaccgcacggtcttgtcgacagttgaagatataatggcgaaa
gatgttatcgacgctgcgaaagcaggcgacgaggtcgcttcgcgtatcgttagccgcgca
gcttactaccttggcaaatcgatggcactgatggctgtcgtgctgaatccggaatgcttt
attatcggcggcggcgtgtcgaaagcaggcgacttcctgttcgaccaaattcgcgaagta
ttcgagaagtatacccagaaggaagcgcaagaaggcgtgaagatcgttgcggctacgctt
ggcaataacgcgggtgttgtaggcgcagcgggtcttatcttgcgttcctaa

DBGET integrated database retrieval system