KEGG   Paenibacillus sp. JDR-2: Pjdr2_0179Help
Entry
Pjdr2_0179        CDS       T00977                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pjdr2_0179
   01230 Biosynthesis of amino acids
    Pjdr2_0179
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pjdr2_0179
   00051 Fructose and mannose metabolism
    Pjdr2_0179
   00562 Inositol phosphate metabolism
    Pjdr2_0179
Enzymes [BR:pjd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pjdr2_0179
Exosome [BR:pjd04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pjdr2_0179
  Exosomal proteins of bladder cancer cells
   Pjdr2_0179
  Exosomal proteins of melanoma cells
   Pjdr2_0179
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
194509..195264
Genome map
AA seq 251 aa AA seqDB search
MSRTPIIAGNWKMFKTVSEAVSFFSEVKGKAEVAGVESVICAPYTTLPALVEAAKGTSIA
IGAQNLHFEDNGAFTGEISGVMLKDLGVKYVIIGHSERRAYFAETDEIVNKKMHSAFKHG
ITPIVCVGEKLEEREANQTKDVCKVQTEAAFEGLSAAQAAEVVIAYEPIWAIGTGKSSTS
EDAQDVIGYIRSVVADLYDAATAEAVRIQYGGSVKPNNVAEYMGQADIDGALVGGASLEP
ASYIALVEGAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagcagaacacctatcattgcaggtaactggaaaatgttcaaaaccgtttccgaagcc
gtatcgttcttctccgaagtcaaaggcaaggctgaagttgctggcgtagagagcgtaatt
tgcgctccttacacaactcttcccgcgcttgttgaagcagcaaaaggcacgtcgatcgca
attggcgcgcaaaacctgcacttcgaagacaacggtgcattcacaggcgaaatcagcggc
gttatgctgaaggaccttggcgtgaagtacgttattatcggtcactccgagcgtcgtgct
tacttcgctgagacagacgagatcgttaacaaaaaaatgcattcagcattcaaacacggc
attacgccaatcgtttgcgtcggcgaaaagctcgaagagcgcgaagctaaccaaacgaag
gatgtttgcaaagtgcaaaccgaggcggcttttgaaggcctgtcggcagctcaagctgct
gaagttgttatcgcatatgagccaatctgggcgatcggcactggcaaatcctcgacttcc
gaagacgcgcaagacgtgatcggttacatccgcagcgtagttgctgatctctacgatgca
gcaacggctgaagcggttcgtatccaatacggcggcagcgtaaaacctaacaacgttgca
gaatacatgggacaagcggatatcgacggcgctcttgtcggcggcgcatcgcttgaaccg
gcttcctatatcgcactcgttgagggggccaagtaa

DBGET integrated database retrieval system