KEGG   Paenibacillus sp. JDR-2: Pjdr2_0364Help
Entry
Pjdr2_0364        CDS       T00977                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pjd  Paenibacillus sp. JDR-2
Pathway
pjd00040  Pentose and glucuronate interconversions
pjd00052  Galactose metabolism
pjd00500  Starch and sucrose metabolism
pjd00520  Amino sugar and nucleotide sugar metabolism
pjd01100  Metabolic pathways
pjd01130  Biosynthesis of antibiotics
Module
pjd_M00362  Nucleotide sugar biosynthesis, prokaryotes
pjd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pjd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pjdr2_0364
   00052 Galactose metabolism
    Pjdr2_0364
   00500 Starch and sucrose metabolism
    Pjdr2_0364
   00520 Amino sugar and nucleotide sugar metabolism
    Pjdr2_0364
Enzymes [BR:pjd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pjdr2_0364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACS99044
JGI: Pjdr2_0364
UniProt: C6CS92
Position
432489..433385
Genome map
AA seq 298 aa AA seqDB search
MKVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAIASGIEDILIISGRGK
RAIEDHFDKSYELEDMLAKKGKTKELEQIRGISEMANIHYTRQKEPKGLGHAIWCARSFV
GNEPFAVLLGDDIVQSEDPCLSQLIRVYDRYQSSVVGVQRVADEDVSKYGIIAPRGSSIE
PSVFFLDGLVEKPSKKAAPSNYAIMGRYVLSPEIFDILEHQSPGAGDEIQLTDAIKKLND
QRNVLAYNFEGVRYDVGDKFGFIKAQLDFALQRDDLQKDVLGYLQQVYEKHFITKAAN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgcgtaaagcgataattccagctgccggtctcggcacccgattcctgcctgca
acaaaagctcagccgaaggaaatgctgccgatcgtggacaagccgactatccaatacatc
attgaagaagcgattgcttccggcattgaggacattctgatcatcagcggccgcggcaag
cgggcgattgaggaccattttgacaagtcgtacgagcttgaggacatgcttgccaagaaa
ggcaagacgaaggagcttgagcaaatccgcggcatctccgagatggcgaacattcactac
acccgtcaaaaagagcctaaaggccttggccacgccatctggtgcgcacgcagctttgtg
ggtaacgagccgtttgccgtactgcttggcgatgatattgtacagtccgaggatccatgc
ctcagccaactgatccgcgtctatgaccgctatcagtcttcggttgttggcgtgcagcgc
gtagccgatgaggatgtatccaaatacgggataatcgctcctcgcggatcgtcgatcgag
ccgtcggtctttttcctggatggcctggtggagaagccttcgaaaaaagccgctccttcc
aattacgcgattatgggccgttacgtgctgtcgccggagattttcgatattctcgagcat
caatccccgggcgcgggagacgaaattcagctgaccgatgcgatcaagaagctgaacgac
cagcgcaacgtgcttgcttacaactttgaaggcgtccgttacgacgtaggcgataagttt
ggttttatcaaagcacaactcgacttcgcgctgcagcgcgacgatctgcagaaggatgta
ctgggctacctgcagcaagtatacgaaaagcattttattacgaaggcggcgaactaa

DBGET integrated database retrieval system